SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602417|ref|NP_245489.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602417|ref|NP_245489.1|
Domain Number 1 Region: 18-211
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 4.5e-69
Family Hypothetical protein YecM (EC4020) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602417|ref|NP_245489.1|
Sequence length 211
Comment hypothetical protein PM0552 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIPFFPYSEKIKREKMITFNPSHDLCNQYAEHFVQFRTFEHNIQQLAEIMHLDLSQYEID
HIALRVNTEQSAKYWLTLLLKYGTILSDNLVNGRIIYLIKLDSPLLFLGQSIDVIELPFP
KNKSYPVEGWEHIEIVMPFLPHETVEKWVARINHTFLWELSDNLNVKLSEPRVEGEQLLN
PSIAVSFVDKQHNPTCIKVHPYHIKKIIEAE
Download sequence
Identical sequences Q9CN85
272843.PM0552 gi|15602417|ref|NP_245489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]