SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602424|ref|NP_245496.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602424|ref|NP_245496.1|
Domain Number 1 Region: 101-289
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.4e-50
Family Formate/glycerate dehydrogenases, NAD-domain 0.00017
Further Details:      
 
Domain Number 2 Region: 1-121
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 1.08e-28
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602424|ref|NP_245496.1|
Sequence length 316
Comment glycerate dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLKIVFLDSTAIPKHIPIPRPSFPHQWVEYEHTTPDQVVERMQDVDIAVTSKVLFSREVM
QQLPKLKLIAITATGTNNVDLVAAQELGITVKNVTGYSSTTVPEHVIGLIYALKHSIMSW
YRDQLSAKWADCKQFCYFDYPITDVKGSTLGVVGRGCLGSEIGRLATALGMNVLYAEHKG
AKTCREGYTPFEDVLAQADILTLHCPLTDTTQNLINQDTLALMKKGAFLINTGRGPLVDE
QALVAALESGHLGGAAVDVLVKEPPEKNNSIIQAATRLPNLIVTPHIAWASDSAVTTLVN
KVKQNIEDFVKNEQIA
Download sequence
Identical sequences Q9CN80
272843.PM0559 gi|15602424|ref|NP_245496.1| WP_010906724.1.12311 WP_010906724.1.15732 WP_010906724.1.19996 WP_010906724.1.62389 WP_010906724.1.66990 WP_010906724.1.81885 WP_010906724.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]