SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602432|ref|NP_245504.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602432|ref|NP_245504.1|
Domain Number 1 Region: 95-292
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.93e-38
Family Phosphate binding protein-like 0.012
Further Details:      
 
Domain Number 2 Region: 2-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.96e-22
Family LysR-like transcriptional regulators 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602432|ref|NP_245504.1|
Sequence length 293
Comment DNA-binding transcriptional activator GcvA [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MYKRLPPLNSLKAFESAARHLSFTKAAEELFVTQAAISHQIKLLEDFLGITLFKRKNRSL
ELTELGKAYFTDVNKILRRLVEATEKLLAQKNDKHLTISVPQTFGMQWLVPHLSEFNQRY
PEIEVRLKGVDQDEGVLNKDIDIAIYYGQGNWDNLQVEKLVEENLLILASPKLLAHNPIH
SKEDLKHHTLIHIHTRDNWQNMANFLQLEDLNIQQGPLFSHTFMALQAAIHGQGLVLANR
LLAQQEIDHGHLQIVLPTNLHDPKSFYVVNHFDVNDERIQAFRAWIIETMKQK
Download sequence
Identical sequences A0A1E3XIM7 Q9CN72 V4MQH9
272843.PM0567 gi|383310210|ref|YP_005363020.1| gi|378774275|ref|YP_005176518.1| gi|386834312|ref|YP_006239627.1| gi|15602432|ref|NP_245504.1| WP_005726382.1.10027 WP_005726382.1.10721 WP_005726382.1.11214 WP_005726382.1.11947 WP_005726382.1.12156 WP_005726382.1.12311 WP_005726382.1.1307 WP_005726382.1.15732 WP_005726382.1.17217 WP_005726382.1.17980 WP_005726382.1.18123 WP_005726382.1.19996 WP_005726382.1.20287 WP_005726382.1.21657 WP_005726382.1.22153 WP_005726382.1.2313 WP_005726382.1.23830 WP_005726382.1.24757 WP_005726382.1.26616 WP_005726382.1.26777 WP_005726382.1.27416 WP_005726382.1.27592 WP_005726382.1.28084 WP_005726382.1.29697 WP_005726382.1.30617 WP_005726382.1.34253 WP_005726382.1.35562 WP_005726382.1.35978 WP_005726382.1.3807 WP_005726382.1.38246 WP_005726382.1.3839 WP_005726382.1.39152 WP_005726382.1.40210 WP_005726382.1.40787 WP_005726382.1.41297 WP_005726382.1.41351 WP_005726382.1.41462 WP_005726382.1.41657 WP_005726382.1.41667 WP_005726382.1.4211 WP_005726382.1.42512 WP_005726382.1.42943 WP_005726382.1.43687 WP_005726382.1.44741 WP_005726382.1.45422 WP_005726382.1.47685 WP_005726382.1.4808 WP_005726382.1.49053 WP_005726382.1.50853 WP_005726382.1.51342 WP_005726382.1.52066 WP_005726382.1.52585 WP_005726382.1.52859 WP_005726382.1.53852 WP_005726382.1.55074 WP_005726382.1.55401 WP_005726382.1.57420 WP_005726382.1.57956 WP_005726382.1.58111 WP_005726382.1.58257 WP_005726382.1.58450 WP_005726382.1.58628 WP_005726382.1.58910 WP_005726382.1.59455 WP_005726382.1.60664 WP_005726382.1.61860 WP_005726382.1.62016 WP_005726382.1.6219 WP_005726382.1.62389 WP_005726382.1.6332 WP_005726382.1.63549 WP_005726382.1.65482 WP_005726382.1.65878 WP_005726382.1.66934 WP_005726382.1.66990 WP_005726382.1.70689 WP_005726382.1.72215 WP_005726382.1.73917 WP_005726382.1.74955 WP_005726382.1.75804 WP_005726382.1.78987 WP_005726382.1.79347 WP_005726382.1.79593 WP_005726382.1.80223 WP_005726382.1.80589 WP_005726382.1.80911 WP_005726382.1.81885 WP_005726382.1.8281 WP_005726382.1.83579 WP_005726382.1.86541 WP_005726382.1.87897 WP_005726382.1.88402 WP_005726382.1.89773 WP_005726382.1.90081 WP_005726382.1.90179 WP_005726382.1.91495 WP_005726382.1.92478 WP_005726382.1.93940 WP_005726382.1.94432 WP_005726382.1.94435 WP_005726382.1.9746 WP_005726382.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]