SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602444|ref|NP_245516.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602444|ref|NP_245516.1|
Domain Number 1 Region: 3-234
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.47e-59
Family Tyrosine-dependent oxidoreductases 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602444|ref|NP_245516.1|
Sequence length 252
Comment NADP-dependent dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKIALVTGATAGFGTAICRTLIQHNYNVIGTGRRAERLAALQQEFGADFLPLAFDLCDR
HATEKAINNLPQAWQAVDLLVNNAGLALGLDRADKAELDDWIQMINTNITGLVTVTRLLL
PQMVSRNQGHIINLGSIAGTYPYPGGNVYGASKAFIKQFSLNLRADLAGTAIRVTNIEPG
LCGGTEFSNVRFKGDDQRAAKLYEDVQFVTPEDIANIVLWANQQPEHVNINRIEVMPTAQ
SSAPLNVVKQTK
Download sequence
Identical sequences A0A2J9R4K9 Q9CN62
gi|15602444|ref|NP_245516.1| WP_005726408.1.12311 WP_005726408.1.15732 WP_005726408.1.17980 WP_005726408.1.19996 WP_005726408.1.24757 WP_005726408.1.26777 WP_005726408.1.27592 WP_005726408.1.36022 WP_005726408.1.40210 WP_005726408.1.40787 WP_005726408.1.41351 WP_005726408.1.41667 WP_005726408.1.45422 WP_005726408.1.4808 WP_005726408.1.53852 WP_005726408.1.55074 WP_005726408.1.58111 WP_005726408.1.6219 WP_005726408.1.62389 WP_005726408.1.66990 WP_005726408.1.70689 WP_005726408.1.79593 WP_005726408.1.81885 WP_005726408.1.8281 WP_005726408.1.88402 WP_005726408.1.89773 WP_005726408.1.92478 WP_005726408.1.93940 WP_005726408.1.95718 WP_005726408.1.9746 WP_005726408.1.9947 272843.PM0579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]