SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602458|ref|NP_245530.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602458|ref|NP_245530.1|
Domain Number 1 Region: 243-525
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.38e-97
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000016
Further Details:      
 
Domain Number 2 Region: 64-241
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.7e-64
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000000964
Further Details:      
 
Domain Number 3 Region: 529-636
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.02e-32
Family Anticodon-binding domain of Class II aaRS 0.0000116
Further Details:      
 
Domain Number 4 Region: 3-61
Classification Level Classification E-value
Superfamily TGS-like 9.48e-16
Family TGS domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602458|ref|NP_245530.1|
Sequence length 643
Comment threonyl-tRNA synthetase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MPIITLPDGSQRQFEQPISVMDVAASIGAGLAKACIAGRVNGERKDACDLITEDSKLEII
TAKEEDGLEIIRHSCAHLLGHAIKQLFPNVKMAIGPTIDKGFYYDVDLDRSLTQEDLDAL
EKRMLELAKTNYDVVKKVVSWQEARDTFEARGEPYKMAILDENIDRCDTPALYHHEEYVD
MCRGPHVPNMRFCHHFKLMKVAGAYWRGDSKNKMLQRIYGTAWADKKQLSEYLTRLEEAA
KRDHRKIGKALDLYHMQEEAPGMVFWHNDGWTIFRELETFVRTKLKEYDYQEVKGPFMMD
RVLWEKTGHWQNYGDLMFTTQSENREYAIKPMNCPGHVQIFNQGLKSYRDLPIRMAEFGS
CHRNEPSGSLHGLMRVRGFTQDDAHIFCTEDQIESEVTACIKMVYDIYSTFGFENIQVKL
STRPEKRIGADEMWDRAEAGLAAALSHNGLEYEIQEGEGAFYGPKIEFALRDCLDREWQC
GTIQLDFALPGRLNASYVAEDNDRRTPVMIHRAILGSIERFIGIITEEYAGFFPAWLAPT
QAIVMNITDSQSDYVQKVVKTLSDAGLRVKSDLRNEKIGFKIREHTLRRVPYMLVCGDKE
IEAGKVAVRTRKGADLGTFTIEEFLDILKKQVRSRELKLLGEE
Download sequence
Identical sequences A0A126QH74 A0A2K2YZB5 P57857 V4N6J9
272843.PM0593 WP_010906743.1.10027 WP_010906743.1.10721 WP_010906743.1.12311 WP_010906743.1.1307 WP_010906743.1.15732 WP_010906743.1.17217 WP_010906743.1.18123 WP_010906743.1.19996 WP_010906743.1.20287 WP_010906743.1.21657 WP_010906743.1.22153 WP_010906743.1.2313 WP_010906743.1.23830 WP_010906743.1.26616 WP_010906743.1.26777 WP_010906743.1.27416 WP_010906743.1.27592 WP_010906743.1.27664 WP_010906743.1.29697 WP_010906743.1.30617 WP_010906743.1.34253 WP_010906743.1.35978 WP_010906743.1.39152 WP_010906743.1.40210 WP_010906743.1.41462 WP_010906743.1.41657 WP_010906743.1.42512 WP_010906743.1.42943 WP_010906743.1.44741 WP_010906743.1.45422 WP_010906743.1.47685 WP_010906743.1.4808 WP_010906743.1.50853 WP_010906743.1.51342 WP_010906743.1.52066 WP_010906743.1.53852 WP_010906743.1.57420 WP_010906743.1.58450 WP_010906743.1.58628 WP_010906743.1.58910 WP_010906743.1.59455 WP_010906743.1.60664 WP_010906743.1.61860 WP_010906743.1.62016 WP_010906743.1.6219 WP_010906743.1.62389 WP_010906743.1.65482 WP_010906743.1.65878 WP_010906743.1.66934 WP_010906743.1.66990 WP_010906743.1.73917 WP_010906743.1.74955 WP_010906743.1.75804 WP_010906743.1.80223 WP_010906743.1.80589 WP_010906743.1.80911 WP_010906743.1.81885 WP_010906743.1.8281 WP_010906743.1.86541 WP_010906743.1.87897 WP_010906743.1.89773 WP_010906743.1.90081 WP_010906743.1.90179 WP_010906743.1.91495 WP_010906743.1.94432 WP_010906743.1.94435 WP_010906743.1.9746 WP_010906743.1.9947 gi|378774302|ref|YP_005176545.1| gi|15602458|ref|NP_245530.1| gi|386834284|ref|YP_006239599.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]