SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602465|ref|NP_245537.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602465|ref|NP_245537.1|
Domain Number 1 Region: 20-332
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.57e-41
Family MoCo biosynthesis proteins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602465|ref|NP_245537.1|
Sequence length 377
Comment hypothetical protein PM0600 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAFFSPKTNFHLMAKPSSFHCNIQCEYCFYLEKEHTFGSKAPFMSEQTLRNYVKNYIESH
AGQRVEFAWQGGEPTLLGLDFFKRAVSFQQEFANGKTITNAFQTNGIALNRQWAAFFKQH
QFLIGLSVDGLSAVHNRYRITSNGQPTFDRVVKALALLKEYQVDFNTLTVVNDQNWHKGK
ETYLALKALGSTFMQFIPIVEQHADHLQTFSVPSEGYGHFLVDVFNEWKKQDVGRIFVLE
FDNLLGQWLGYPSSSCIHQPTCGKSLVVEANGDVYSCDHFVYPEYKIGNLNHTSLAELVQ
SPKQSHFGFAKQGQLTQICRQCEFKSLCHGGCPKHRISSVEGEHFKHNYLCASYQYFFRQ
TAEDMQQMSNQIRFAKT
Download sequence
Identical sequences Q9CN44
272843.PM0600 WP_010906747.1.12311 WP_010906747.1.15732 WP_010906747.1.19996 WP_010906747.1.40210 WP_010906747.1.45422 WP_010906747.1.4808 WP_010906747.1.53852 WP_010906747.1.6219 WP_010906747.1.62389 WP_010906747.1.66990 WP_010906747.1.81885 WP_010906747.1.8281 WP_010906747.1.89773 WP_010906747.1.9746 WP_010906747.1.9947 gi|15602465|ref|NP_245537.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]