SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602470|ref|NP_245542.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602470|ref|NP_245542.1|
Domain Number 1 Region: 2-164
Classification Level Classification E-value
Superfamily Peptide methionine sulfoxide reductase 4.84e-75
Family Peptide methionine sulfoxide reductase 0.00000884
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602470|ref|NP_245542.1|
Sequence length 174
Comment methionine sulfoxide reductase A [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTQQAIFAGGCFWCVEAVFNQIKGVEKATSGYINGTTENPTYKEVCTGETGHAEAVKVEF
DATVISYEKLLDIFFSIHNPTQLNHQGEDVGTQYRTGIYYLNDEQEQLANKKIAELQPHF
AEKIVTEVLPAQTFYPAEDYHQGYLLQNPQNSYCNLVATPKFLKAKVKFEEIWK
Download sequence
Identical sequences Q9CN40
gi|15602470|ref|NP_245542.1| WP_005722174.1.11014 WP_005722174.1.12311 WP_005722174.1.15732 WP_005722174.1.19996 WP_005722174.1.40210 WP_005722174.1.42469 WP_005722174.1.45422 WP_005722174.1.4808 WP_005722174.1.53852 WP_005722174.1.6219 WP_005722174.1.62389 WP_005722174.1.66990 WP_005722174.1.81885 WP_005722174.1.8281 WP_005722174.1.89773 WP_005722174.1.90578 WP_005722174.1.9746 WP_005722174.1.9947 272843.PM0605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]