SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602476|ref|NP_245548.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602476|ref|NP_245548.1|
Domain Number 1 Region: 8-472
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.1e-127
Family DnaQ-like 3'-5' exonuclease 0.000000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602476|ref|NP_245548.1|
Sequence length 475
Comment exonuclease I [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSTSPDFSFFIYDYESFGVDPASDRPAQFAGIRTDINFNIISDPVMFYCKQTNDYLPAPE
AVLVTGITPQECNEKGIPEPEFAERILQEFSRPNTCVMGFNNIRYDDEMTRYTFYRNFID
PYEYSWKNGNSRWDLLDLVRACYALRPEGINWAYDEEGMPSFRLEKLTKANGIEHSNAHD
AMADVYATIAMAKLIKEKQPKLFQYFFENRGKKEVEKLIDTANLTPLVHVSGMLGNHRGN
TTWIVPLAWHPTNQNAVICCDLAANITDLLNKDANELRQNLYTPKAELIEKGILPVPLKL
VHINKCPILAPAKTLLPENAARLGIDRTFCLENLQRLKLSPPIRDKVTEIFNEERHFAPS
INVETELYNGFFDYNDKNNMAILRHLPEEKLAEHGLAFKDTRIPKLLFHYRARHYFNSLT
RAEQIQWQKYRHKKLDQVALQFEQSLQRLIAENSENPTNLALLQKVYEYGAKILA
Download sequence
Identical sequences Q9CN34
272843.PM0611 WP_010906752.1.19996 WP_010906752.1.66990 WP_010906752.1.9947 gi|15602476|ref|NP_245548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]