SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602483|ref|NP_245555.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602483|ref|NP_245555.1|
Domain Number 1 Region: 205-451
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.98e-75
Family Leukotriene A4 hydrolase catalytic domain 0.0015
Further Details:      
 
Domain Number 2 Region: 3-194
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 4.05e-47
Family Leukotriene A4 hydrolase N-terminal domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602483|ref|NP_245555.1|
Sequence length 869
Comment aminopeptidase N [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQAKAKYRKDYRTPDFTVTEIALDFQLDPKKTVVTATSQFRRLNPQAQKLRLDGHSFQFS
SLKLNGRDFKHFEQDGESLSLNLSTVDADQFSLEVVSILSPEKNTSLQGLYQSGEGICTQ
CEAEGFRQITYMLDRPDVLARYTTKITADKSKYPYLLSNGNRVDSGELPDGRHWVEWHDP
FPKPSYLFALVAGDFDVLSDTFTTKSGREVALELFVDRGNLDRAEWAMQSLKRSMKWDED
RFGLEYDLDIYMIVAVDFFNMGAMENKGLNVFNSKFVLANPQTATDEDYIAVESVIAHEY
FHNWTGNRITCRDWFQLSLKEGLTVFRDQEFTSDLWSRSGKRIEDVRLLRTAQFAEDASP
MSHPIRPDKVIEMNNFYTMTVYEKGAEVIRMMHTLLGETLFQKGMQLYVSEQDGKAATCE
DFVSAMERASGIDLTQFRHWYSQSGTPELTITDSYDPETAVYTLHVAQHTPPTADQMEKV
NLHIPLKIALYDKNGQAQVLENDGQIINPVLDVKQAEQSFQFTGVKSKPVPALLCDFSAP
VKLHYEYSTAQLITLLRHAENQFVRWDVAQMLYAAELRRNLTRYQQGKSLEFSAEVLAEL
YQILDGYQQDPELATLILTLPKVTEFAELFKTIDPEGISVVRDFMVRTIAESLKQTLLKV
YNDIRLEVYRVNAEDIALRALRNLCVSYLAYTTVGNNLVNKHYSYANNMTDTLAALSAAT
QAQLPCRDTLLADFESKWQHDGLVMDKWFALQATRPDDDVLLNVMKLMDHPSFNFNNPNR
LRALVGSFANHNLKAFHAIDGSGYRFLTDILIRLNESNPQVASRLIEPLIRFSRYDGQRQ
TLMKRGLERLSEVENISRDLYEKIEKALQ
Download sequence
Identical sequences Q9CN28
gi|15602483|ref|NP_245555.1| 272843.PM0618 WP_010906757.1.66990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]