SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602484|ref|NP_245556.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602484|ref|NP_245556.1|
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 9.68e-66
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.000000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602484|ref|NP_245556.1|
Sequence length 166
Comment phosphoribosylaminoimidazole carboxylase catalytic subunit [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSNCTPQIAIVMGSKSDWATMQEATHILDELQIPYHVEVVSAHRTPDKLFTFAETASAKG
YKVIIAGAGGAAHLPGMIASKTLVPVLGVPVKSSMLSGVDSLYSIVQMPKGIPVGTLAIG
PAGAANAGLLAAQILAAFDTSLLTRLTAFREKQTNSVLENPDPRMP
Download sequence
Identical sequences A0A2J9QJ50 Q9CN27
272843.PM0619 gi|15602484|ref|NP_245556.1| WP_010906758.1.4211 WP_010906758.1.66990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]