SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602490|ref|NP_245562.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602490|ref|NP_245562.1|
Domain Number 1 Region: 13-289
Classification Level Classification E-value
Superfamily Radical SAM enzymes 3.66e-70
Family MoCo biosynthesis proteins 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602490|ref|NP_245562.1|
Sequence length 337
Comment molybdenum cofactor biosynthesis protein A [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQTIPIKHVGNDPLVDAFQRRYYYLRLSITDVCNFRCNYCLPNGYQPESNKPSFLTLNEI
RLVVKSFANMGTEKVRITGGEPTLRKDFLPIVETIAQNPTIKQIALTTNGYRMAKDVAAW
KEAGITSINVSIDSLDARMFHRITGIDKFEDVMRGLERAFEVGYQKIKVNSVLMRDLNDA
DFNQFLTWIKDKPIQMRFIELMQTGEMDHFFQQHHVSGQLLADKLINAGWTLQSKGLLDG
PAKVFKHPDYVGEVGLIMPYEKNFCASCNRLRVSAKGKLHLCLFGEEGITLRDLLQSDDQ
QLQLQARISSALQGKREHHFLHQGDSGVRANLASIGG
Download sequence
Identical sequences Q9CN21
gi|15602490|ref|NP_245562.1| WP_010906760.1.12311 WP_010906760.1.15732 WP_010906760.1.19996 WP_010906760.1.40210 WP_010906760.1.45422 WP_010906760.1.4808 WP_010906760.1.53852 WP_010906760.1.6219 WP_010906760.1.62389 WP_010906760.1.66990 WP_010906760.1.81885 WP_010906760.1.8281 WP_010906760.1.89773 WP_010906760.1.9746 WP_010906760.1.9947 272843.PM0625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]