SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602494|ref|NP_245566.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602494|ref|NP_245566.1|
Domain Number 1 Region: 196-395
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.76e-76
Family B3/B4 domain of PheRS, PheT 0.0000134
Further Details:      
 
Domain Number 2 Region: 467-690
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.19e-52
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000792
Further Details:      
 
Domain Number 3 Region: 36-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.43e-48
Family Myf domain 0.0024
Further Details:      
 
Domain Number 4 Region: 696-794
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 7.98e-31
Family Anticodon-binding domain of PheRS 0.00057
Further Details:      
 
Domain Number 5 Region: 404-475
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 6.04e-20
Family Domains B1 and B5 of PheRS-beta, PheT 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602494|ref|NP_245566.1|
Sequence length 795
Comment phenylalanyl-tRNA synthetase subunit beta [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKFSESWVREWVNPAISTAQLCDQITMLGLEVDGVEKVAGDFSGVVVGEVVECAQHPDAD
KLRVTKVNVGGDRLLDIVCGAPNCRQGLKVACATEGAVLPGDFKIKKTKLRGQPSEGMLC
SFSELGIDVESSGIIELPQNAPVGTNLRDYLTLDDNTVEISLTPNRADCLSIAGIAREIG
VVNKLAVNTPHFESVKATITDKVDIQLHAPEACPRYLLRVVKNVNVQAPSPMWLQEKLRR
CGIRSIDPVVDVTNYILLELGQPMHAFDAAKVAQPVQVRMAKSGEALVLLDGSTAKLKDN
TLLIADQNGPLAMAGIFGGQASGVNAETKDIILEAAFFAPLAIAGRARQYGLHTDSSHRF
ERGVDFELQRQAMERATALLVEICGGEVGDICEVASDAFLPKLNQVSLRREKLDALLGHH
IETETVTDILTRLGLQVSYANDVWQVTSASWRFDIEIEEDLVEEIARIYGYNSIPNKAPL
AHLRMREHKEADLDLARIKTALVDADYQEAITYSFVDPKIQSVLHPQQDALVLPNPISVE
MSAMRLSLLSGLLGAVQYNQNRQQTRVRLFETGLRFIPDTQAEFGVRQEFVLAAVMTGNK
KAEHWAGKAESVDFFDLKGDLESILSLTGTRNLVKFVAKSYPALHPGQSAAIMLNGEEIG
FIGTLHPNAAKQLGLNGKTVVFEILWQAIATRQVVQAKEISRFPANRRDLAIVVAESVAA
SDVLDACREVAGETLTQVNLFDVYQGNGVAEGHKSLAISLIIQDNEKTLEEDDINAVVSV
VLSELKQRFNAYLRD
Download sequence
Identical sequences P57859
gi|15602494|ref|NP_245566.1| 272843.PM0629 WP_010906762.1.12311 WP_010906762.1.15732 WP_010906762.1.19996 WP_010906762.1.40210 WP_010906762.1.45422 WP_010906762.1.4808 WP_010906762.1.53852 WP_010906762.1.6219 WP_010906762.1.62389 WP_010906762.1.66990 WP_010906762.1.81885 WP_010906762.1.8281 WP_010906762.1.89773 WP_010906762.1.9746 WP_010906762.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]