SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602496|ref|NP_245568.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602496|ref|NP_245568.1|
Domain Number 1 Region: 91-327
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.58e-81
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000475
Further Details:      
 
Domain Number 2 Region: 13-99
Classification Level Classification E-value
Superfamily tRNA-binding arm 9.42e-22
Family Phenylalanyl-tRNA synthetase (PheRS) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602496|ref|NP_245568.1|
Sequence length 327
Comment phenylalanyl-tRNA synthetase subunit alpha [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQNLEQITEQALDAIARAEDGKALDAIRVEYFGKKGPFTALMQGLRDVSPEARPAVGQKI
NDAKQLAQNALNEKKVQLETAELNAQLAKEKIDVSLPGRKVETGGLHPVTMTIDRVTKFF
SELGFSVESGPEIESDYYNFDALNIPKHHPARADHDTFWFNPELLLRTQTSGVQIRTMEK
MQPPIRIMAPGRVYRNDYDQTHTPMFHQIELLYVDKKANFTELKGLLHDFLRAFFEEDLQ
VRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNVLRNVGIDPNEYAGFAVGMGVE
RLTMLRYNVTDLRAFFENDLRFLKQFK
Download sequence
Identical sequences A0A1E3XHF3 A0A2K2YZA9 P57860 V4N8K6
gi|386834246|ref|YP_006239561.1| 272843.PM0631 WP_005726492.1.10027 WP_005726492.1.10721 WP_005726492.1.11214 WP_005726492.1.11947 WP_005726492.1.12156 WP_005726492.1.12311 WP_005726492.1.1307 WP_005726492.1.14908 WP_005726492.1.15732 WP_005726492.1.17217 WP_005726492.1.17980 WP_005726492.1.18123 WP_005726492.1.19996 WP_005726492.1.20287 WP_005726492.1.21657 WP_005726492.1.22153 WP_005726492.1.2313 WP_005726492.1.23830 WP_005726492.1.24757 WP_005726492.1.26616 WP_005726492.1.26777 WP_005726492.1.27416 WP_005726492.1.27592 WP_005726492.1.27664 WP_005726492.1.28084 WP_005726492.1.29697 WP_005726492.1.30617 WP_005726492.1.34253 WP_005726492.1.35562 WP_005726492.1.35978 WP_005726492.1.3807 WP_005726492.1.38246 WP_005726492.1.3839 WP_005726492.1.39152 WP_005726492.1.3957 WP_005726492.1.40210 WP_005726492.1.40787 WP_005726492.1.41462 WP_005726492.1.41657 WP_005726492.1.42512 WP_005726492.1.42943 WP_005726492.1.43687 WP_005726492.1.44741 WP_005726492.1.45422 WP_005726492.1.47685 WP_005726492.1.4808 WP_005726492.1.49053 WP_005726492.1.50853 WP_005726492.1.51342 WP_005726492.1.52066 WP_005726492.1.52585 WP_005726492.1.52859 WP_005726492.1.53852 WP_005726492.1.55074 WP_005726492.1.55401 WP_005726492.1.57420 WP_005726492.1.58257 WP_005726492.1.58450 WP_005726492.1.58628 WP_005726492.1.58910 WP_005726492.1.59455 WP_005726492.1.60478 WP_005726492.1.60664 WP_005726492.1.61098 WP_005726492.1.61860 WP_005726492.1.62016 WP_005726492.1.6219 WP_005726492.1.62389 WP_005726492.1.6332 WP_005726492.1.63549 WP_005726492.1.65482 WP_005726492.1.65878 WP_005726492.1.66934 WP_005726492.1.66990 WP_005726492.1.70689 WP_005726492.1.72215 WP_005726492.1.73917 WP_005726492.1.74955 WP_005726492.1.75804 WP_005726492.1.78987 WP_005726492.1.79347 WP_005726492.1.80223 WP_005726492.1.80589 WP_005726492.1.80911 WP_005726492.1.81885 WP_005726492.1.8281 WP_005726492.1.83579 WP_005726492.1.86541 WP_005726492.1.87897 WP_005726492.1.89773 WP_005726492.1.90081 WP_005726492.1.90179 WP_005726492.1.91495 WP_005726492.1.94432 WP_005726492.1.94435 WP_005726492.1.9746 gi|378774339|ref|YP_005176582.1| gi|15602496|ref|NP_245568.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]