SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602517|ref|NP_245589.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602517|ref|NP_245589.1|
Domain Number 1 Region: 2-154
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.63e-41
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 129-278
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 9.81e-24
Family Glucose 6-phosphate dehydrogenase-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602517|ref|NP_245589.1|
Sequence length 350
Comment hypothetical protein PM0652 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSKIIHVGIAGFGMSAKTFHTPFLHQDPRFCIHKVFERQSDKAKSIYPYITTVRDFTQLL
EEDIDLVLITTPNQTHYDFAKKAILAGKHVIVEKPLAITAQQAEELDVLAQKHHVMLSVY
QNRRWDSGALTVKKLIAENTLGEIVEYEIRYERYSPSKNKKAWKETGELGTGLVYDLGVH
LIDEVLDLFGMPKALFADVTKQNPESGSDDSFRITFYYADHKKVTLSSTKYAREPAPHII
LQGKLGSYIKPKLDNQEALLMAGVQPKGDWNKESEQDWGILHTEIDGLIVRQKLEPISGN
YQAYYDNIYAVLTKNAPLLVTAKQATTVLKLIEKVYESAALGQKIYLVNQ
Download sequence
Identical sequences A0A126QD53 A0A2K2Z027 Q9CMZ8 V4N8I6
272843.PM0652 gi|386834225|ref|YP_006239540.1| WP_005754062.1.10027 WP_005754062.1.10721 WP_005754062.1.12311 WP_005754062.1.1307 WP_005754062.1.14908 WP_005754062.1.15732 WP_005754062.1.17217 WP_005754062.1.18123 WP_005754062.1.19996 WP_005754062.1.20287 WP_005754062.1.22153 WP_005754062.1.2313 WP_005754062.1.23830 WP_005754062.1.26616 WP_005754062.1.26777 WP_005754062.1.27416 WP_005754062.1.27592 WP_005754062.1.27664 WP_005754062.1.29697 WP_005754062.1.30617 WP_005754062.1.34253 WP_005754062.1.35978 WP_005754062.1.39152 WP_005754062.1.3957 WP_005754062.1.40210 WP_005754062.1.41297 WP_005754062.1.41462 WP_005754062.1.41657 WP_005754062.1.42512 WP_005754062.1.42943 WP_005754062.1.44741 WP_005754062.1.45422 WP_005754062.1.47685 WP_005754062.1.4808 WP_005754062.1.50853 WP_005754062.1.52066 WP_005754062.1.53852 WP_005754062.1.57420 WP_005754062.1.57956 WP_005754062.1.58450 WP_005754062.1.58628 WP_005754062.1.58910 WP_005754062.1.59455 WP_005754062.1.60664 WP_005754062.1.61098 WP_005754062.1.61860 WP_005754062.1.62016 WP_005754062.1.6219 WP_005754062.1.62389 WP_005754062.1.65482 WP_005754062.1.65878 WP_005754062.1.66934 WP_005754062.1.66990 WP_005754062.1.73917 WP_005754062.1.74955 WP_005754062.1.75804 WP_005754062.1.80223 WP_005754062.1.80589 WP_005754062.1.80911 WP_005754062.1.81885 WP_005754062.1.8281 WP_005754062.1.86541 WP_005754062.1.87897 WP_005754062.1.89773 WP_005754062.1.90081 WP_005754062.1.90179 WP_005754062.1.91495 WP_005754062.1.94432 WP_005754062.1.94435 WP_005754062.1.9746 WP_005754062.1.9947 gi|15602517|ref|NP_245589.1| gi|383310295|ref|YP_005363105.1| gi|378774360|ref|YP_005176603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]