SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602525|ref|NP_245597.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602525|ref|NP_245597.1|
Domain Number 1 Region: 88-313
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.78e-43
Family Phosphate binding protein-like 0.0000000979
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000106
Family LysR-like transcriptional regulators 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602525|ref|NP_245597.1|
Sequence length 323
Comment transcriptional regulator CysB [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKIQQLRYIVEIVNQNLNVTEAANALFTSQPGISKQVRLLEDELGLEIFERNGKHIKSLT
PAGQKIVAIARELLVKTQSIRAVANEYTQPNHGVLRIATTNTQARYVLPPVIERFSKKYP
DVSLHIHQGSPTQIYDALLSGEVDIAITTEAQYLFDDVVLLPCYMWNRSVLIKHDHPLAQ
CKNLTIEELGKYPLVTYTFGFTGVSDLDYAFNRAGILPNIVFTATDADVIKTYVRLGLGV
GIMASMAHTKDDGDLLALNADHLFNPSTVQIAFKHSTFLRAYMYDFIQYFSPHLTRELVE
KAERLRDNNAVKKLFEGIELAIR
Download sequence
Identical sequences A0A1E3XIF2 A0A2K2YZZ5 Q9CMZ0 V4N6D9
WP_005726527.1.10027 WP_005726527.1.10721 WP_005726527.1.11014 WP_005726527.1.11214 WP_005726527.1.11947 WP_005726527.1.12156 WP_005726527.1.12311 WP_005726527.1.1307 WP_005726527.1.15732 WP_005726527.1.17217 WP_005726527.1.17980 WP_005726527.1.18123 WP_005726527.1.19996 WP_005726527.1.20287 WP_005726527.1.21657 WP_005726527.1.22153 WP_005726527.1.2313 WP_005726527.1.23830 WP_005726527.1.26616 WP_005726527.1.27416 WP_005726527.1.27592 WP_005726527.1.27664 WP_005726527.1.28084 WP_005726527.1.29697 WP_005726527.1.30617 WP_005726527.1.34253 WP_005726527.1.35562 WP_005726527.1.35978 WP_005726527.1.36022 WP_005726527.1.3807 WP_005726527.1.38246 WP_005726527.1.3839 WP_005726527.1.39152 WP_005726527.1.40210 WP_005726527.1.40787 WP_005726527.1.41297 WP_005726527.1.41351 WP_005726527.1.41462 WP_005726527.1.41657 WP_005726527.1.41667 WP_005726527.1.4211 WP_005726527.1.42469 WP_005726527.1.42512 WP_005726527.1.42943 WP_005726527.1.43687 WP_005726527.1.44741 WP_005726527.1.45422 WP_005726527.1.47685 WP_005726527.1.4808 WP_005726527.1.49053 WP_005726527.1.50853 WP_005726527.1.51342 WP_005726527.1.52066 WP_005726527.1.52585 WP_005726527.1.52859 WP_005726527.1.53852 WP_005726527.1.55074 WP_005726527.1.55401 WP_005726527.1.57420 WP_005726527.1.57956 WP_005726527.1.58111 WP_005726527.1.58257 WP_005726527.1.58450 WP_005726527.1.58628 WP_005726527.1.58910 WP_005726527.1.59455 WP_005726527.1.60478 WP_005726527.1.60664 WP_005726527.1.61860 WP_005726527.1.62016 WP_005726527.1.6219 WP_005726527.1.62389 WP_005726527.1.6332 WP_005726527.1.63549 WP_005726527.1.65482 WP_005726527.1.65878 WP_005726527.1.66934 WP_005726527.1.66990 WP_005726527.1.70689 WP_005726527.1.72215 WP_005726527.1.73917 WP_005726527.1.74955 WP_005726527.1.75804 WP_005726527.1.78987 WP_005726527.1.79347 WP_005726527.1.79593 WP_005726527.1.80223 WP_005726527.1.80589 WP_005726527.1.80911 WP_005726527.1.81885 WP_005726527.1.8281 WP_005726527.1.83579 WP_005726527.1.86541 WP_005726527.1.87897 WP_005726527.1.88402 WP_005726527.1.89773 WP_005726527.1.90081 WP_005726527.1.90179 WP_005726527.1.90578 WP_005726527.1.91495 WP_005726527.1.92478 WP_005726527.1.93940 WP_005726527.1.94432 WP_005726527.1.94435 WP_005726527.1.95718 WP_005726527.1.9746 WP_005726527.1.9947 272843.PM0660 gi|378774367|ref|YP_005176610.1| gi|386834195|ref|YP_006239510.1| gi|15602525|ref|NP_245597.1| gi|383310329|ref|YP_005363139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]