SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602529|ref|NP_245601.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602529|ref|NP_245601.1|
Domain Number 1 Region: 90-238
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.89e-38
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00000177
Further Details:      
 
Domain Number 2 Region: 242-367
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 3.91e-38
Family TyrA dimerization domain-like 0.00000089
Further Details:      
 
Domain Number 3 Region: 3-88
Classification Level Classification E-value
Superfamily Chorismate mutase II 7.51e-26
Family Dimeric chorismate mutase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602529|ref|NP_245601.1|
Sequence length 374
Comment bifunctional chorismate mutase/prephenate dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MDTLNKLRTQIDQVDRQLLQLLAQRLELVKQVGEVKHQQGLPIYVPEREAEMLNARRAEA
ETLGVSADLIEDVLRRIMRESYARENQFGFKTVNPAIKKIVIVGGGGKLGSLFARYFTLS
GYYVEILEQQDWQSADKILNETDVIVVSVPIAKTVETIKRLKPYLTDNMLLVDLTSVKRA
PLQAMLDVHAGAVLGLHPMFGPDIASMAKQVIVRCDGRFESRYQWLITQIQIWGAKFYQV
EATEHDHSMTYVQALRHFSTFANGLHLSKQPVQLANLLALSSPIYCLELAMIGRLFAQDA
ELYADIILDKPENLAVIESLKQSYEESLAFFTHGDKQAFIDSFEQVKQWFGEYSEQFLKE
SRQLLQQANDYRQI
Download sequence
Identical sequences Q9CMY6
gi|15602529|ref|NP_245601.1| WP_010906781.1.12311 WP_010906781.1.15732 WP_010906781.1.19996 WP_010906781.1.40210 WP_010906781.1.45422 WP_010906781.1.4808 WP_010906781.1.53852 WP_010906781.1.6219 WP_010906781.1.62389 WP_010906781.1.66990 WP_010906781.1.81885 WP_010906781.1.8281 WP_010906781.1.89773 WP_010906781.1.9746 WP_010906781.1.9947 272843.PM0664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]