SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602534|ref|NP_245606.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602534|ref|NP_245606.1|
Domain Number 1 Region: 157-307
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.27e-24
Family Universal stress protein-like 0.0048
Further Details:      
 
Domain Number 2 Region: 3-155
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.09e-21
Family Universal stress protein-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602534|ref|NP_245606.1|
Sequence length 312
Comment universal stress protein UspE [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKFNNILVILNPENEKQYALARAVRLVKEQKSHQKVRITVFLSVYDLSYEMSALLSSEER
AEMHQGVIEQRTLAIQPYLEKYADPNIEFETKVVWHSNEAEAITHEVEKHEYDLVVKYTK
EEESITSLIFTPMDWQLLRKCPKPLLMVRDGNWKHQRRILIAVNVADDEEKNHKVFNEQL
VSLGIDLADKLERGNVHLVTAYPPTPINMAIDLPEFNSGEYEKNIRGQYLLNMKALRQQF
SIDEDHTHVREGFPEEVIPQVAKELEAELVVLGTIGRTGLSAAFLGNTAEHVINKLNCSL
LAIKPDNPEESN
Download sequence
Identical sequences A0A1E3XIB1 A0A2K2YZV9 Q9CMY1 V4N6D1
gi|378774376|ref|YP_005176619.1| 272843.PM0669 gi|15602534|ref|NP_245606.1| gi|383310341|ref|YP_005363151.1| WP_005726552.1.10027 WP_005726552.1.11014 WP_005726552.1.12311 WP_005726552.1.1307 WP_005726552.1.15732 WP_005726552.1.17217 WP_005726552.1.18123 WP_005726552.1.19996 WP_005726552.1.20287 WP_005726552.1.21657 WP_005726552.1.22153 WP_005726552.1.2313 WP_005726552.1.23830 WP_005726552.1.24757 WP_005726552.1.26616 WP_005726552.1.26777 WP_005726552.1.27416 WP_005726552.1.27592 WP_005726552.1.27664 WP_005726552.1.29697 WP_005726552.1.30617 WP_005726552.1.34253 WP_005726552.1.35978 WP_005726552.1.36022 WP_005726552.1.39152 WP_005726552.1.40210 WP_005726552.1.40787 WP_005726552.1.41297 WP_005726552.1.41351 WP_005726552.1.41462 WP_005726552.1.41657 WP_005726552.1.41667 WP_005726552.1.42469 WP_005726552.1.42512 WP_005726552.1.44741 WP_005726552.1.45422 WP_005726552.1.47685 WP_005726552.1.4808 WP_005726552.1.50853 WP_005726552.1.51342 WP_005726552.1.52066 WP_005726552.1.53852 WP_005726552.1.57420 WP_005726552.1.57956 WP_005726552.1.58111 WP_005726552.1.58450 WP_005726552.1.58628 WP_005726552.1.59455 WP_005726552.1.60664 WP_005726552.1.61860 WP_005726552.1.62016 WP_005726552.1.6219 WP_005726552.1.62389 WP_005726552.1.65482 WP_005726552.1.65878 WP_005726552.1.66934 WP_005726552.1.66990 WP_005726552.1.70689 WP_005726552.1.73917 WP_005726552.1.74955 WP_005726552.1.75804 WP_005726552.1.79593 WP_005726552.1.80589 WP_005726552.1.80911 WP_005726552.1.81885 WP_005726552.1.8281 WP_005726552.1.86541 WP_005726552.1.87897 WP_005726552.1.88402 WP_005726552.1.89773 WP_005726552.1.90179 WP_005726552.1.90578 WP_005726552.1.91495 WP_005726552.1.92478 WP_005726552.1.93940 WP_005726552.1.94432 WP_005726552.1.95718 WP_005726552.1.9746 WP_005726552.1.9947 gi|386834186|ref|YP_006239501.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]