SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602543|ref|NP_245615.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602543|ref|NP_245615.1|
Domain Number 1 Region: 67-512
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.44e-88
Family Phosphate binding protein-like 0.00000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602543|ref|NP_245615.1|
Sequence length 523
Comment hypothetical protein PM0678 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MFSDASFSRYKTNMMTHLKSAVFSGLIFCLTACDQPTSVSSSLSAPPVSDMTPSREKLTR
AVYHDLILNPHQMTNAEQAIFLQDLLEGLTAYDTAGHPVPAVAESWQSEDYKTWFFILRE
GAQWSNGDAVTAQDFVHSWQNLASSTSPLKTYLAFLNLANADAVLKGSMPVADLGIEAIE
HRVLRIQLDKPTPALPAMLAHVALLPTYQKESAQFVSNGAYRLVNQQDDFIHLEKNPHYW
AHQKVSFKFVDYQKISASQPVSNIDWVLAPQHTLTPLQYFPTLCTHYYEFNLKHPLLQKS
AVRKALISMISTRSIVQDVVPYMQATTQFLPYSMQMDSDLAWEPVVVEQVLEQQGITESK
PLQFTLTYDQQPPNVEIAQRLIRMWSQSDMIRVKAQPVAWQQLLEKRAKRDFEVIRSGWC
ADYNEPSAFLNIFYSQAADNQAGYHHAEVDKLLEQTLLLQTETERKHLYSKITTQLQQDY
VVLPIFQYTTPIFIHPTVTGYHLDNPTGTMYSKDLYRKVSEHK
Download sequence
Identical sequences Q9CMX3
272843.PM0678 WP_010906786.1.12311 WP_010906786.1.15732 WP_010906786.1.19996 WP_010906786.1.40210 WP_010906786.1.45422 WP_010906786.1.4808 WP_010906786.1.53852 WP_010906786.1.6219 WP_010906786.1.62389 WP_010906786.1.66990 WP_010906786.1.81885 WP_010906786.1.8281 WP_010906786.1.89773 WP_010906786.1.9746 WP_010906786.1.9947 gi|15602543|ref|NP_245615.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]