SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602549|ref|NP_245621.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602549|ref|NP_245621.1|
Domain Number 1 Region: 1-168
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 4.71e-44
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00047
Further Details:      
 
Domain Number 2 Region: 172-329
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.53e-31
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00048
Further Details:      
 
Domain Number 3 Region: 332-429
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 2.75e-26
Family Glutamyl tRNA-reductase dimerization domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602549|ref|NP_245621.1|
Sequence length 434
Comment glutamyl-tRNA reductase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTILVIGINHKTASVAIREKVAFSAEKRVEALAQIQQQALAESAVILSTCNRTEVYFHHK
AIPPQEAESWTARCMQWFAEIHQLSLDALAGCLYSQQNQQAVLHLMRVACGLDSLVLGEP
QILGQVKDAYQLSKMYYQGQNQPLSSEFSRLFQKTFSVAKRVRTETNIGGNAVSVAYGAC
SLARQIFDSLKTLNVLLVGAGETIELTCRHLLRHGVQRIMIANRTFERAQHLVTKLDGAE
NVQVLALTQLQEGLNQADIVISSTGSPTILITQDMVKIAQKARCDLPMLLVDIAVPRDIE
ESVGELDSIYHYTVDDLQTIIQRNLVEREKASAQAWVIIQQECADFFEWLKVHQFSNLIR
SYRENAEDIRQILLEKALLALRQGEDSEAVLQALSYKLTNKLLHSPTQVMNAMVKTGNST
GLALFSSTLKSDVE
Download sequence
Identical sequences A0A2J9QIY0 P95525
272843.PM0684 WP_010906790.1.4211 WP_010906790.1.66990 gi|15602549|ref|NP_245621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]