SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602570|ref|NP_245642.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602570|ref|NP_245642.1|
Domain Number 1 Region: 395-710
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 2.1e-93
Family Phosphotransacetylase 0.000000315
Further Details:      
 
Domain Number 2 Region: 1-240
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-28
Family Nitrogenase iron protein-like 0.045
Further Details:      
 
Domain Number 3 Region: 229-354
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 1.29e-23
Family DRTGG domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602570|ref|NP_245642.1|
Sequence length 712
Comment phosphate acetyltransferase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSRTIILIPISAGVGLTSVSLGLTHALEQKGAKVGFMKPISQPNSGEDMIDRTTSIIRTS
TTIETSEPFMLSVAESLIGQNQSDVVLEKIVENHQQLAKNNEIVVVEGLIPTRKHSYANS
INYEIAQALDAEIILVAAPATETPAELKERIKAAASLFGSKNNPNLLGVVINKFNAPIDE
SGRTRPDLAEIFDSFQHTQNQVSEIYHLFEKSPIKILACIPWSAELIATRAIDLAKHLGA
AIIHEGAINERRIRGITFCARNLTNMVEHFRVGSLLVTSADRPDVIVAAALSAMNGVEIA
GVLLTGGYKIDAQIKKLCQHAIESTGLPVFRVEGNTWQTALALQSFNLEVPVDDKERIEK
IKHYISDLLDSNFIDSLAAASSRLRRLSPPAFRFQLTELARQAQKRIVLPEGDEPRTVKA
AALCAERGIAECVLLATPESVMRVAEAQGIQLGKGITIIDPATVRENYVARLVELRKNKG
MTEDSAREQLEDNVVLGTMMLEANEVDGLVSGAVHTTANTIRPPMQIIKTAPGNSIVSSI
FFMLLPDQVLVYGDCAVNPDPTAEQLAEIAIQSADSAKAFGIDPKVAMISYSTGTSGSGA
DVEKVKEATRLAQEKRPDLIIDGPLQYDAAVMEDVARSKAPNSPVAGKATVFIFPDLNTG
NTTYKAVQRSADLVSIGPMLQGMRKPVNDLSRGALVDDIVYTIALTAIQATQ
Download sequence
Identical sequences A0A1E3XIQ2 Q9CMV1
gi|378774407|ref|YP_005176650.1| gi|15602570|ref|NP_245642.1| WP_005726628.1.10027 WP_005726628.1.10721 WP_005726628.1.11014 WP_005726628.1.12311 WP_005726628.1.1307 WP_005726628.1.14908 WP_005726628.1.15732 WP_005726628.1.17217 WP_005726628.1.17980 WP_005726628.1.18123 WP_005726628.1.19996 WP_005726628.1.20287 WP_005726628.1.21657 WP_005726628.1.22153 WP_005726628.1.2313 WP_005726628.1.24757 WP_005726628.1.26616 WP_005726628.1.26777 WP_005726628.1.27416 WP_005726628.1.29697 WP_005726628.1.30617 WP_005726628.1.34253 WP_005726628.1.35978 WP_005726628.1.39152 WP_005726628.1.3957 WP_005726628.1.40210 WP_005726628.1.41297 WP_005726628.1.41462 WP_005726628.1.41657 WP_005726628.1.42469 WP_005726628.1.42512 WP_005726628.1.42943 WP_005726628.1.44741 WP_005726628.1.45422 WP_005726628.1.47685 WP_005726628.1.4808 WP_005726628.1.50853 WP_005726628.1.51342 WP_005726628.1.52066 WP_005726628.1.53852 WP_005726628.1.55074 WP_005726628.1.57420 WP_005726628.1.57956 WP_005726628.1.58450 WP_005726628.1.58628 WP_005726628.1.58910 WP_005726628.1.59455 WP_005726628.1.60664 WP_005726628.1.61098 WP_005726628.1.62016 WP_005726628.1.6219 WP_005726628.1.62389 WP_005726628.1.65482 WP_005726628.1.65878 WP_005726628.1.66934 WP_005726628.1.66990 WP_005726628.1.70689 WP_005726628.1.73917 WP_005726628.1.75804 WP_005726628.1.79593 WP_005726628.1.80223 WP_005726628.1.80589 WP_005726628.1.80911 WP_005726628.1.81885 WP_005726628.1.8281 WP_005726628.1.86541 WP_005726628.1.89773 WP_005726628.1.90081 WP_005726628.1.90179 WP_005726628.1.90578 WP_005726628.1.91495 WP_005726628.1.94432 WP_005726628.1.94435 WP_005726628.1.95718 WP_005726628.1.9746 WP_005726628.1.9947 272843.PM0705 gi|386834152|ref|YP_006239467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]