SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602579|ref|NP_245651.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602579|ref|NP_245651.1|
Domain Number 1 Region: 2604-2712
Classification Level Classification E-value
Superfamily Pili subunits 2.35e-21
Family YadA C-terminal domain-like 0.00063
Further Details:      
 
Domain Number 2 Region: 239-414
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 1.44e-19
Family Adhesin YadA, collagen-binding domain 0.00071
Further Details:      
 
Domain Number 3 Region: 570-692
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.00000000000000112
Family Adhesin YadA, collagen-binding domain 0.00056
Further Details:      
 
Domain Number 4 Region: 1108-1218
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.0000000000000105
Family Adhesin YadA, collagen-binding domain 0.0093
Further Details:      
 
Domain Number 5 Region: 391-562
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.0000000000000523
Family Adhesin YadA, collagen-binding domain 0.0012
Further Details:      
 
Domain Number 6 Region: 887-1035
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.000000000000405
Family Adhesin YadA, collagen-binding domain 0.0044
Further Details:      
 
Domain Number 7 Region: 2257-2347
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.000000000902
Family Adhesin YadA, collagen-binding domain 0.012
Further Details:      
 
Domain Number 8 Region: 1289-1357
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.0000000222
Family Adhesin YadA, collagen-binding domain 0.0069
Further Details:      
 
Domain Number 9 Region: 789-881
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.0000000732
Family Adhesin YadA, collagen-binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  gi|15602579|ref|NP_245651.1|
Domain Number - Region: 2210-2236
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.000235
Family Adhesin YadA, collagen-binding domain 0.0067
Further Details:      
 
Domain Number - Region: 1564-1637
Classification Level Classification E-value
Superfamily Trimeric adhesin 0.000235
Family Trimeric adhesin 0.0018
Further Details:      
 
Domain Number - Region: 736-761
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.0034
Family Adhesin YadA, collagen-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602579|ref|NP_245651.1|
Sequence length 2712
Comment hypothetical protein PM0714 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNKVYRVIWSHVTNTFIAVSELATSKGKVKSFSAISSNPQPELNSSIPATFKLSAIALVS
ILAFAPSQVLAQDVNATNLTVSGTSTFTGAATFNNTATFNNMVTAGNVTATTLTVGGKNV
ATKDDVTTLTTTVNQKAAQSEVDNLKNTKADKSDVDNLKNTKAAQSEVDNLKNTKADKSD
VDNLKNIKADKSEVNELKNSKADKSELTKLSNLVTSLGVPEGTTTYTGIKYFRVKSTLDD
AVADGQDSVAIGPKAKTEGVDAVALGHDSTANATESIAIGKKAYAVKTANKGIAIGEHAR
VGSKQDGDVVYDGASSYVLGPKDGESSVAIGDKAVSRGEASIAIGKNAITSNKDAKSQIA
KNNIALGTNAQAIASDNSIALGNAARTNKDSDSSIAIGDSAETKAAHSLAVGTTSKALAE
AALALGKLAEAKGTSSVAMGNTSKADGSNSVAVGNTSQTLQSNTIAIGSSAIANPERTIS
IGLNAGKGQEADATGTKHSQINIGENSGEGVIGQLNIGIGAHAGTNVVGKHNIALGTYAG
TNLKNSEETSGANVSIGHEANKYDQLTAVQKSTVVGAQTKAASRSTALGAEATALGLDAV
AVGITSKAEGDKSVAIGANSTADSNNVALGATSRAVAKEGSGYLTGKQSSLVVSVGHQDG
AADQHILRRLVNVADGVDEQDAATVAQLKKVTEKVTSDLQAQFNALSHAPTASEIKYDTV
PPSPTTGAENKITLKAKTRISNVAPAELDTDAVNLGQVNHIVTKNKAHYFSVNDTGINPV
PGNHDNDGATAKLAMAIGQNAAAKAERSVAIGNNTTVNGEGSIGLGTYYKGSAELDDGVP
RESETTVTKPSKNVKYGIAIGAGTTTDGNNSIAIGSLAATSDKNPGANVDRAIAIGYNAV
SSAEKANAIGDRAVANSVKGNAFGSQALSGAESSTAIGTESKSEGQNAYALGTKSHAKGL
NSIAFGTNQVVSGQNSGSIGYAGELGNAKATVINGEGTYSLGNTNSTLTANESGIFGNSN
EIKAKENARIVGNKNTIGAIEEKPHVPGTPPAAPVNDLKDIYVTGYDNKISSDKKLAKDL
SGLFVYGHGNNIAQLPDPDSTEEFTLTDSSVIGANNTLNTKGKNYFVLGNNVTATLENSV
YLGADSAYTTGNSTSSMNSYADMANGLNKSGYTFAGSQPVGVVTVGAVGKERRVQNVASG
LVTEASTDAINGSQLFALTRPLRFAGDNSTLSNPNGKPGTDVTVISRSSNQGMKVVGGEN
DGNKLTTIADKNIGVIANGDHTLEVRLAKTLSNLKDATFGTGTDKTTINKDGMTITNGAN
TVSLTEGGLNNGGNKITNVAAGQNETDAVNVKQLNDLKAEGFGLTGEDGQTVKQALGTAI
KVTGDDNVKTKIVTDADGSKKLEIGLENQVTLGGEAKNGNPAADGKLTLKNQAGTDKVVL
DGANGTVGLTGADGAQAVITVKKGRPTLDNAAETPRIAYGNEEVATLNDGLKFGANAGDV
HNAKLNTQVDVKGATANTVWDNFDKGQNIMTRVEGNTITVALAKALSGLTSATFGDPASN
PKDSTVINKDGLTITQGDNTVSLTDDGLDNGNKQIKNVASGLTTTNGTATTSLDDAVQTN
GVNVGDLKTAINNITNGTNPLGGFGLKDKAGNTFKQNLGETAQITGDSNVNTKVVDGQNG
GKALEVSLANQLTLGKGPEANVPNATGEAGKITLKDDKGTDRVVVDGSEGAISLTGQPAT
QGAAAPTAKIKVAEGNPDLENTSDDPANPNQNKKTRITYDIAGPNGTTVTEQLATLNDGL
KFGANTGDVHDAKLNTRVDVKGKAENTNWANFDAGQNIMTQISGNTITVALAKALAGLDS
ATFGNPADGSKDGAVINKDGLTITEGDKTVKLTEKGLDNGGNQIINVDSGLKKTDGSVVA
LKDAEGSVLTNGVNVGDLKNAIKDVTSATNGGFGLKDKAGAEFKQDLGTTAQITGDKNIN
TKVIDVPNSNDKALEISLANDITLGKNGADGVDGSLGVNGKDGASVVLNGKDGSIGLTGP
RGQDGSDGKSATISVKDGKAGVDGKDGDTKTRIVYETKDATGKPVVEEVATLNDGMKFVG
NDGKEVTRKLNETLDIKGGLDAATVADNAKVSSSNLGVKTNAEGTGLEIVMKERPTFSGL
VVNGKDGEDAAVKFAKDGKDGMSIAAVTDNDGNATGLTIKDKDGNPGVTFNNDGRITNVT
AGVDDKDAVNVSQLKDGLAKATTKVEAGKNMTVTPTVNQDGSTTYTVATEDNVNFTTVTT
GNTVMNNDGVKVGDNVALTNEGLKAGDVTVTTAGINAGNKKVTGVADGDISPNSTDAVNG
SQLNAVKETAEAGWHLTANGADSSNVKPRNTVDLNNTDGNIVISKTNTADKHNVTFGLAD
NINVKDSVVVGPKGANGKPGEGAVVINAEDGANGKDGISIVGKDGKDAVAISGKDGVGTI
GLTGPAGADGKNANAIIGVNDSVKGLDGNDGKDGNSKTRIVYTKPNGEEEQVATMNDGLV
FGADKGTEHKAKLGTTVKVKGDDKNIETEVAGDTIRVRLKDNIDVKGINVTENLTVKEGA
KINMGNNVIDGVADGEVNATSKQAVNGSQLHKVQQQVNNQATAINKLGDHINKVDKDLRA
GIAGATAVAFLQRPNEAGKSIVSLGVGSYRSESAIAVGYARNSDNNKISIKLGGGMNSRG
DVNFGGSIGYQW
Download sequence
Identical sequences Q7DAY2 Q9F3X5
272843.PM0714 WP_010906810.1.12311 WP_010906810.1.15732 WP_010906810.1.40210 WP_010906810.1.45422 WP_010906810.1.4808 WP_010906810.1.53852 WP_010906810.1.6219 WP_010906810.1.62389 WP_010906810.1.66990 WP_010906810.1.81885 WP_010906810.1.8281 WP_010906810.1.89773 WP_010906810.1.9746 gi|15602579|ref|NP_245651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]