SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602582|ref|NP_245654.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602582|ref|NP_245654.1|
Domain Number 1 Region: 222-741
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.78e-168
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000000000000784
Further Details:      
 
Domain Number 2 Region: 10-221
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 8.11e-72
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602582|ref|NP_245654.1|
Sequence length 756
Comment ribonucleotide-diphosphate reductase subunit alpha [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNKALMVTKRDGHLEPIDLDKIHRVITWAAEGLDNVSVSQVELRSHIQFYEGIRTSDIHE
TIIKAAADLISKDSPDYQYLAARLAVFHLRKKAYGHFDPPRLYDHVKKLVRMGKYDPALL
VDYTREEWDEMDSYLDHWRDMTFSYAAVKQLEGKYLVQNRVTGEIYESAQFLYLLVAASL
FSKYPTETRLSYIRRFYDATSTFKISLPTPIMAGVRTPTRQFSSCVLIECGDSLDSINAT
ASAIVKYVSQRAGIGVNAGAIRALGSPIRGGEAFHTGCIPFYKYFQTAVKSCSQGGVRGG
AATVYYPIWHLEVESLLVLKNNRGVEDNRVRHMDYGVQLNKLMYQRLIKGGDITLFSPSD
VPGLYEAFFADQDKFEQLYLQYEQDPTIRQRSVKAVELFSLLMQERASTGRIYIQNVDHC
NTHSPFDPKVAPVRQSNLCLEIALPTKPLQHFHDEKGEIALCTLSAFNLGTLENLDELEG
LADLAVRALDALLDYQDYPVIAAKKSSLARRSLGIGVINYAYYLAKNGVRYSDSSANDLT
HRTFEAIQYYLLKASMNLAKEIGPCEYFNETTYSQGILPIDTYKKDIDNLTKEPLHYDWE
TLRKEIQEFGLRNSTLTALMPSETSSQISNATNGIEPPRGHVSVKASKDGILKQVVPEYE
TLGENYELLWDLPNNDGYLHLVGIMQKFVDQAISANTNYDPQRFEDGKVPMKRLLGDLLT
AYKYGLKTLYYQNTRDGAEDVQEDIDDGCSGGACKI
Download sequence
Identical sequences Q9CMU1
272843.PM0717 WP_010906813.1.66990 gi|15602582|ref|NP_245654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]