SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602589|ref|NP_245661.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602589|ref|NP_245661.1|
Domain Number 1 Region: 421-566
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.36e-25
Family Histidine kinase 0.014
Further Details:      
 
Domain Number 2 Region: 42-266
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000000242
Family Phosphate binding protein-like 0.058
Further Details:      
 
Domain Number 3 Region: 338-417
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000844
Family Homodimeric domain of signal transducing histidine kinase 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602589|ref|NP_245661.1|
Sequence length 571
Comment protein Tprotein TrS [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKCSSFLKMFILLLSFMPALVYAQQWKIGILAQRGVAHTHATWQPWIDWLNQHLSPHQF
TLVTLDLNDLIQDQAQGVDFILSNQAQFFYLNNNEVRWLVTLRSPRQIQSSTMGRIGSAI
LVRQDSPFHQLTDLRHKTVSAVGDNAFGGFLLGYNEFYQQGLVENKDFQLKFTGFPVDNT
LLLLQERKVDAAIVPVCILEELVNEGVVKKEDFRLLAGKENVLGCLASTELLPNWSLAAL
SQVPDSLASKLVTLLLSQVPAHLPQWTPPYSTSQADTVLRGLYKHPQQNLWDSTKYWLQQ
YQGWIIFVLLLLVLNYLWISFQIHRKSKALQQAYREMRHYEQQLVQADRLSILGEMSTGI
AHEINQPLSAIRMYVEGVKYHLAQLPAEKNTVEILDKVLQQVDRSADIIRNLMNWAKGKK
TPSSECVALKPLLQRVISFMSLQTHQKAQLNLNCPASLKLKIDTTLLEQVLCNCLLNASQ
AGASEIEVNVKAVGEYMTIHIVDNGSGFKAGELAFPFVPFRSSKANGLGLGLVLCQRLMR
SINGDISLHNRLDQQGAEVILKLPNKVGETC
Download sequence
Identical sequences Q9CMT4
WP_010906818.1.12311 WP_010906818.1.14908 WP_010906818.1.15732 WP_010906818.1.19996 WP_010906818.1.21657 WP_010906818.1.27592 WP_010906818.1.3957 WP_010906818.1.40210 WP_010906818.1.41657 WP_010906818.1.42512 WP_010906818.1.45422 WP_010906818.1.4808 WP_010906818.1.51342 WP_010906818.1.53852 WP_010906818.1.61098 WP_010906818.1.6219 WP_010906818.1.62389 WP_010906818.1.66990 WP_010906818.1.81885 WP_010906818.1.8281 WP_010906818.1.89773 WP_010906818.1.94432 WP_010906818.1.9746 WP_010906818.1.9947 gi|15602589|ref|NP_245661.1| 272843.PM0724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]