SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602591|ref|NP_245663.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602591|ref|NP_245663.1|
Domain Number 1 Region: 3-127,237-269
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.09e-53
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0000113
Further Details:      
 
Domain Number 2 Region: 128-237
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.96e-36
Family Dihydrodipicolinate reductase-like 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602591|ref|NP_245663.1|
Sequence length 270
Comment dihydrodipicolinate reductase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTLRVAIVGAGGRMGRQLIQAVSETEGVVLGAAFERQGSSLLGADAGELANVGHLGVQIT
DDLASQQDQFDLLIDFTRPEGTLAHLAFCVAQHKNMVIGTTGFDDDGKAKIQQAADSIGI
VFASNFSVGVNLVFKLLEKAAKVMGDYCDIEIIEAHHRHKVDAPSGTALSMGEHIAKTLG
RDLKTHGVFTRDGITGERKRDEIGFATIRASDVVGEHSVWFADIGERVEIAHKATSRMTF
AKGAVRAAKWLAQKEKGLFDMTDVLDLNQL
Download sequence
Identical sequences P57867
gi|15602591|ref|NP_245663.1| 272843.PM0726 WP_010906819.1.12311 WP_010906819.1.15732 WP_010906819.1.19996 WP_010906819.1.40210 WP_010906819.1.45422 WP_010906819.1.4808 WP_010906819.1.53852 WP_010906819.1.6219 WP_010906819.1.62389 WP_010906819.1.66990 WP_010906819.1.81885 WP_010906819.1.8281 WP_010906819.1.89773 WP_010906819.1.9746 WP_010906819.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]