SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602594|ref|NP_245666.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602594|ref|NP_245666.1|
Domain Number 1 Region: 3-139
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 1.6e-34
Family PurM N-terminal domain-like 0.00056
Further Details:      
 
Domain Number 2 Region: 145-300
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 4.04e-34
Family PurM C-terminal domain-like 0.0000834
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602594|ref|NP_245666.1|
Sequence length 330
Comment hypothetical protein PM0729 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSHGEFDIIQRYFTASKRTARKDVILSIGDDCAITELRQNQRLVITTDTMVENTHFLPSM
HAADLAYKAAVTNLSDLAAMGAEPAWVSLALTLPDVDAQWLSDFSQSFFDVLDHYNVDLI
GGDTTKGPLSVTITAHGIIPKGKGLCRHSASVGDWIYVSGTLGDSAAGLSLLLSQQTPLN
SDHEFLIQRHLRPTPRVLLGLELAVSSLANAAIDISDGFLADLDHILTRSQCGAVIELDK
LPLSSSLVNVFGVEQAETFALSGGEDYELCFTVPDSNKAKLERALAYIGVDYTCVGQVRA
ISPQNKKRIKFQRDGNPIDITIQSGFDHFK
Download sequence
Identical sequences A0A1E3XJF4 A0A2K2Z1K6 Q9CMT0 V4N5A3
gi|386834127|ref|YP_006239442.1| 272843.PM0729 gi|15602594|ref|NP_245666.1| gi|383310401|ref|YP_005363211.1| WP_005716408.1.10027 WP_005716408.1.10721 WP_005716408.1.11214 WP_005716408.1.11947 WP_005716408.1.12156 WP_005716408.1.12311 WP_005716408.1.1307 WP_005716408.1.15732 WP_005716408.1.17217 WP_005716408.1.18123 WP_005716408.1.19996 WP_005716408.1.20287 WP_005716408.1.21657 WP_005716408.1.22153 WP_005716408.1.2313 WP_005716408.1.23830 WP_005716408.1.24757 WP_005716408.1.26616 WP_005716408.1.26777 WP_005716408.1.27416 WP_005716408.1.27592 WP_005716408.1.27664 WP_005716408.1.28084 WP_005716408.1.29697 WP_005716408.1.30617 WP_005716408.1.34253 WP_005716408.1.35562 WP_005716408.1.35978 WP_005716408.1.36022 WP_005716408.1.3807 WP_005716408.1.38246 WP_005716408.1.3839 WP_005716408.1.39152 WP_005716408.1.40210 WP_005716408.1.40787 WP_005716408.1.41297 WP_005716408.1.41351 WP_005716408.1.41462 WP_005716408.1.41657 WP_005716408.1.41667 WP_005716408.1.42512 WP_005716408.1.42943 WP_005716408.1.43687 WP_005716408.1.44741 WP_005716408.1.45422 WP_005716408.1.47685 WP_005716408.1.4808 WP_005716408.1.49053 WP_005716408.1.50853 WP_005716408.1.51342 WP_005716408.1.52066 WP_005716408.1.52585 WP_005716408.1.52859 WP_005716408.1.53852 WP_005716408.1.55401 WP_005716408.1.57420 WP_005716408.1.57956 WP_005716408.1.58111 WP_005716408.1.58257 WP_005716408.1.58450 WP_005716408.1.58628 WP_005716408.1.58910 WP_005716408.1.59455 WP_005716408.1.60478 WP_005716408.1.60664 WP_005716408.1.61860 WP_005716408.1.62016 WP_005716408.1.6219 WP_005716408.1.62389 WP_005716408.1.6332 WP_005716408.1.63549 WP_005716408.1.65482 WP_005716408.1.65878 WP_005716408.1.66934 WP_005716408.1.66990 WP_005716408.1.70689 WP_005716408.1.72215 WP_005716408.1.73917 WP_005716408.1.74955 WP_005716408.1.75804 WP_005716408.1.78987 WP_005716408.1.79347 WP_005716408.1.80223 WP_005716408.1.80589 WP_005716408.1.80911 WP_005716408.1.81885 WP_005716408.1.8281 WP_005716408.1.83579 WP_005716408.1.86541 WP_005716408.1.87897 WP_005716408.1.88402 WP_005716408.1.89773 WP_005716408.1.90081 WP_005716408.1.90179 WP_005716408.1.91495 WP_005716408.1.92478 WP_005716408.1.93940 WP_005716408.1.94432 WP_005716408.1.94435 WP_005716408.1.95718 WP_005716408.1.9746 gi|378774434|ref|YP_005176677.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]