SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602599|ref|NP_245671.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602599|ref|NP_245671.1|
Domain Number 1 Region: 37-263
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.72e-67
Family Prokaryotic proteases 0.000000305
Further Details:      
 
Domain Number 2 Region: 254-363
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-25
Family HtrA-like serine proteases 0.00036
Further Details:      
 
Domain Number 3 Region: 390-455
Classification Level Classification E-value
Superfamily PDZ domain-like 9.86e-16
Family HtrA-like serine proteases 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602599|ref|NP_245671.1|
Sequence length 459
Comment hypothetical protein PM0734 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MRKRRFLLTSIALGLSILSTPMISQASLPTQVDGQQVPSLAPMLEKVLPAVVSISVEGKA
KNHGSTPFQGIPEEFRFFFGPDLFNDRAPRNFRGIGSGVIINAEKGYVLTNNHVIDSADK
ITVQLQDGRELSAKVIGTDELSDVALIQIEKPKNLTALTIADSDKLRVGDFTVAIGNPFG
LGQTVTSGIVSALGRSTGSDNGTYENYIQTDAAVNRGNSGGPLINLQGELIGINTAIISP
SGGNAGIAFAIPSNMANNLVQQILEFGEVRRGMLGIKGGELNADLAKAFDIEAQQGAFVS
EVLPNSAAEKAGLKAGDVIVAMNGQKISSFAEMRAKIATSGAGKEIALTYLRDGKTHQTK
VTLQSDDQTQADASHLLPALAGAEMSNHDDKGVKGVLITSVTPKSLAEQRGLKKGDVIIG
VNRQKVENLGQLRKILDAKPSAIALNIVRGNTNFYLLIQ
Download sequence
Identical sequences Q9CMS7
272843.PM0734 WP_010906824.1.12311 WP_010906824.1.15732 WP_010906824.1.19996 WP_010906824.1.40210 WP_010906824.1.45422 WP_010906824.1.4808 WP_010906824.1.53852 WP_010906824.1.6219 WP_010906824.1.62389 WP_010906824.1.66990 WP_010906824.1.81885 WP_010906824.1.8281 WP_010906824.1.89773 WP_010906824.1.9746 WP_010906824.1.9947 gi|15602599|ref|NP_245671.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]