SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602609|ref|NP_245681.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602609|ref|NP_245681.1|
Domain Number 1 Region: 25-251
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.52e-63
Family Phosphate binding protein-like 0.00000085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602609|ref|NP_245681.1|
Sequence length 254
Comment hypothetical protein PM0744 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLKLKMITVSLATACLAFSLSAQAKVTVFAAASMTNALNQIAEDYKKVKPDQELVFSFAS
SSTLAKQIEEGAPVDIFVSANTKWMKHLSDKGLTIKDTEKVLVGNELVLIAPEASQLKEV
DVAKGEWVAELKDSFLSVGDPDHVPAGQYAKEALTNLKLWDKVEAKLARGKDVRAALALV
ERAEAPLGIVYSTDGKVSKGVKIVGVFPADTYKAVEYPVALLKDRDNAETREFLNYLESA
EAKKVLVSYGFSVK
Download sequence
Identical sequences A0A1D7R1Q5 A0A2K2Z040 Q9CMR8 V4N5B5
gi|15602609|ref|NP_245681.1| WP_005754159.1.10027 WP_005754159.1.10721 WP_005754159.1.11014 WP_005754159.1.12311 WP_005754159.1.1307 WP_005754159.1.14908 WP_005754159.1.15732 WP_005754159.1.17217 WP_005754159.1.18123 WP_005754159.1.19996 WP_005754159.1.20287 WP_005754159.1.22153 WP_005754159.1.2313 WP_005754159.1.23830 WP_005754159.1.24757 WP_005754159.1.26616 WP_005754159.1.27416 WP_005754159.1.27592 WP_005754159.1.27664 WP_005754159.1.29697 WP_005754159.1.30617 WP_005754159.1.34253 WP_005754159.1.35978 WP_005754159.1.39152 WP_005754159.1.3957 WP_005754159.1.40210 WP_005754159.1.40787 WP_005754159.1.41297 WP_005754159.1.41351 WP_005754159.1.41462 WP_005754159.1.41667 WP_005754159.1.42469 WP_005754159.1.42512 WP_005754159.1.42943 WP_005754159.1.44741 WP_005754159.1.45422 WP_005754159.1.47685 WP_005754159.1.4808 WP_005754159.1.50853 WP_005754159.1.52066 WP_005754159.1.53852 WP_005754159.1.55074 WP_005754159.1.57420 WP_005754159.1.57956 WP_005754159.1.58111 WP_005754159.1.58450 WP_005754159.1.58628 WP_005754159.1.58910 WP_005754159.1.59455 WP_005754159.1.60664 WP_005754159.1.61098 WP_005754159.1.61860 WP_005754159.1.62016 WP_005754159.1.6219 WP_005754159.1.62389 WP_005754159.1.65482 WP_005754159.1.65878 WP_005754159.1.66934 WP_005754159.1.66990 WP_005754159.1.73917 WP_005754159.1.74955 WP_005754159.1.75804 WP_005754159.1.80223 WP_005754159.1.80589 WP_005754159.1.80911 WP_005754159.1.81885 WP_005754159.1.8281 WP_005754159.1.86541 WP_005754159.1.87897 WP_005754159.1.88402 WP_005754159.1.89773 WP_005754159.1.90081 WP_005754159.1.90179 WP_005754159.1.90578 WP_005754159.1.91495 WP_005754159.1.92478 WP_005754159.1.93940 WP_005754159.1.94432 WP_005754159.1.94435 WP_005754159.1.9746 WP_005754159.1.9947 gi|383310417|ref|YP_005363227.1| 272843.PM0744 gi|378774449|ref|YP_005176692.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]