SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602614|ref|NP_245686.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602614|ref|NP_245686.1|
Domain Number 1 Region: 149-368
Classification Level Classification E-value
Superfamily Dihydrofolate reductase-like 1.11e-58
Family RibD C-terminal domain-like 0.00027
Further Details:      
 
Domain Number 2 Region: 8-150
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.22e-45
Family Deoxycytidylate deaminase-like 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602614|ref|NP_245686.1|
Sequence length 376
Comment hypothetical protein PM0749 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MMTFTAQDVVYMQMALELAEKGQFTTTPNPSVGCVLVKDGIIVGRGFHVKAGEAHAEVMA
LREAGENARGATAYVTLEPCSHFGRTPPCAQGLIDAGVVKVVSAMCDPNPQVAGRGLSML
SDAGIESAVGLLAEKAEWLNRGFLKRMRTGRPYVQLKMAMSLDGRTAMANGESKWITGEL
ARADVQAERAKASAILSTSATVLADDPLLNVRWQQLPDKVKADYTQAQLRQPVRVILDSQ
HRVQPSHRLFSLSSPVWLVSQTARSLLEFPAHCEQIQLSASTNALADLMAELGQRQINTL
WIEAGATLAGALIEAKLVDELIIYIAPKLLGDAARGLCKLPHLSTLAEASLWQLHSIEKL
GDDLKTIYHPRITEPT
Download sequence
Identical sequences Q9CMR3
272843.PM0749 gi|15602614|ref|NP_245686.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]