SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602617|ref|NP_245689.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602617|ref|NP_245689.1|
Domain Number 1 Region: 301-474
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 6.54e-80
Family Transhydrogenase domain III (dIII) 0.00000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602617|ref|NP_245689.1|
Sequence length 474
Comment pyridine nucleotide transhydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSEGLVQAAYIVAALLFIMSLAGLSKHETAKAGCWYGIVGMAIALVATIFGPQSAGTFWI
LIAMAVGAVIGIKRALKVEMTEMPELVAILHSFVGLAAVLVGFNSYGLHHEAVMPANLDA
AAQAAFIAEQQVLSNIHNVEVFLGIFIGAVTFTGSVVAFGKLRGIIDSKALTLPHRHKLN
LAAIVVSALLMVSFLNSPENIFPVLLMTAIALAFGWHLVASIGGADMPVVVSMLNSYSGW
AAAAAGFMLSNDLLIVTGALVGSSGAILSYIMCKAMNRSFISVIAGGFGNDPVASSDEEQ
GEHRETTAEEVAELLKNSSSVIITPGYGMAVAQAQYPVAEITQKLRERGINVRFGIHPVA
GRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDTVLVIGANDTVNPAAMDDPNSPIAG
MPVLEVWKAQNVIVFKRSMNTGYAGVQNPLFFKDNTQMLFGDAKDRVDDILKAL
Download sequence
Identical sequences A0A1E3XJD1 A0A2K2Z051 Q9CMR0 V4PW76
272843.PM0752 gi|15602617|ref|NP_245689.1| gi|386834102|ref|YP_006239417.1| WP_005726734.1.10027 WP_005726734.1.10721 WP_005726734.1.11214 WP_005726734.1.11947 WP_005726734.1.12156 WP_005726734.1.12311 WP_005726734.1.1307 WP_005726734.1.14908 WP_005726734.1.15732 WP_005726734.1.17217 WP_005726734.1.17980 WP_005726734.1.18123 WP_005726734.1.19996 WP_005726734.1.20287 WP_005726734.1.22153 WP_005726734.1.2313 WP_005726734.1.23830 WP_005726734.1.24757 WP_005726734.1.26616 WP_005726734.1.27416 WP_005726734.1.27592 WP_005726734.1.27664 WP_005726734.1.28084 WP_005726734.1.29697 WP_005726734.1.30617 WP_005726734.1.34253 WP_005726734.1.35562 WP_005726734.1.35978 WP_005726734.1.36022 WP_005726734.1.3807 WP_005726734.1.38246 WP_005726734.1.3839 WP_005726734.1.39152 WP_005726734.1.3957 WP_005726734.1.40210 WP_005726734.1.40787 WP_005726734.1.41351 WP_005726734.1.41462 WP_005726734.1.41657 WP_005726734.1.41667 WP_005726734.1.4211 WP_005726734.1.42512 WP_005726734.1.42943 WP_005726734.1.43687 WP_005726734.1.44741 WP_005726734.1.45422 WP_005726734.1.47685 WP_005726734.1.4808 WP_005726734.1.49053 WP_005726734.1.52066 WP_005726734.1.52585 WP_005726734.1.52859 WP_005726734.1.53852 WP_005726734.1.55401 WP_005726734.1.57420 WP_005726734.1.58111 WP_005726734.1.58257 WP_005726734.1.58450 WP_005726734.1.58910 WP_005726734.1.59455 WP_005726734.1.60478 WP_005726734.1.60664 WP_005726734.1.61098 WP_005726734.1.61860 WP_005726734.1.62016 WP_005726734.1.6219 WP_005726734.1.62389 WP_005726734.1.6332 WP_005726734.1.63549 WP_005726734.1.65482 WP_005726734.1.65878 WP_005726734.1.66934 WP_005726734.1.66990 WP_005726734.1.70689 WP_005726734.1.72215 WP_005726734.1.73917 WP_005726734.1.75804 WP_005726734.1.78987 WP_005726734.1.79347 WP_005726734.1.79593 WP_005726734.1.80223 WP_005726734.1.80589 WP_005726734.1.80911 WP_005726734.1.81885 WP_005726734.1.8281 WP_005726734.1.83579 WP_005726734.1.87897 WP_005726734.1.88402 WP_005726734.1.89773 WP_005726734.1.90081 WP_005726734.1.90179 WP_005726734.1.91495 WP_005726734.1.92478 WP_005726734.1.93940 WP_005726734.1.94432 WP_005726734.1.94435 WP_005726734.1.95718 WP_005726734.1.9746 gi|378774456|ref|YP_005176699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]