SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602618|ref|NP_245690.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602618|ref|NP_245690.1|
Domain Number 1 Region: 1-168
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 9.35e-56
Family L-alanine dehydrogenase-like 0.0000673
Further Details:      
 
Domain Number 2 Region: 137-305
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3e-38
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602618|ref|NP_245690.1|
Sequence length 509
Comment NAD(P) transhydrogenase subunit alpha [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLIGVPRELLDNESRVAATPKTVQQILKLGFEVIVEHHAGFKASFEDQAFAETGAKIGSA
QEVWQSDIIFKVNAPTDSEIALIKEGATLVSFIWPAQNPDLMEKLSAKKINVLAMDAVPR
ISRAQSLDALSSMANIAGYRAVVEAAHEFGSFFTGQITAAGKVPPAKVLVIGAGVAGLAA
IGAANSLGAIVRAFDSRPEVKEQVESMGASFLEIDFQEEGGSGDGYAKVMSEEFNRRALA
LYAEQAKEVDIIITTALIPGKPAPRLISKEMVASMKPGSVIVDLAAATGGNCELSKAGEV
VVTDNQVKIIGYTDLPSRLPTQSSQLYGTNLVNLLKLLCKEKDGKISIDFDDVVLRGVTV
IRDGEVTWPAPPIQVSAQPQKVKATLVEKKEVKAVDPRKKYGAMAVAALLFMALASVAPA
AFLSHFTVFVLACVVGYYVVWNVSHALHTPLMSVTNAISGIIIVGALLQIAQGNFFISIL
AFIAILVASINIFGGFKVTQRMLAMFRKD
Download sequence
Identical sequences Q9CMQ9
272843.PM0753 WP_010906835.1.19996 WP_010906835.1.40210 WP_010906835.1.45422 WP_010906835.1.4808 WP_010906835.1.53852 WP_010906835.1.6219 WP_010906835.1.66990 WP_010906835.1.8281 WP_010906835.1.89773 WP_010906835.1.9746 gi|15602618|ref|NP_245690.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]