SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602622|ref|NP_245694.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602622|ref|NP_245694.1|
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 1.44e-34
Family Ribosome-binding factor A, RbfA 0.00000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602622|ref|NP_245694.1|
Sequence length 132
Comment ribosome-binding factor A [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAREFKRSDRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSDLAYAKVFVTFLFDND
ESAIDAGMKGLEKASPYIRSLLGKAMRLRIVPEIRFIYDRSLIEGMRMSNLVSNVIREDN
ARHIDDDVSEEK
Download sequence
Identical sequences A0A1E3XJK0 A0A2K2Z0N2 J6CQZ1 P57872
272843.PM0757 gi|15602622|ref|NP_245694.1| WP_005716528.1.10027 WP_005716528.1.10721 WP_005716528.1.11014 WP_005716528.1.11214 WP_005716528.1.11947 WP_005716528.1.12156 WP_005716528.1.12311 WP_005716528.1.1307 WP_005716528.1.14908 WP_005716528.1.15732 WP_005716528.1.17217 WP_005716528.1.17980 WP_005716528.1.18123 WP_005716528.1.19996 WP_005716528.1.20287 WP_005716528.1.21657 WP_005716528.1.22153 WP_005716528.1.2313 WP_005716528.1.23830 WP_005716528.1.24757 WP_005716528.1.26616 WP_005716528.1.26777 WP_005716528.1.27416 WP_005716528.1.27592 WP_005716528.1.27664 WP_005716528.1.28084 WP_005716528.1.29697 WP_005716528.1.30617 WP_005716528.1.34253 WP_005716528.1.35562 WP_005716528.1.35978 WP_005716528.1.36022 WP_005716528.1.3807 WP_005716528.1.38246 WP_005716528.1.3839 WP_005716528.1.39152 WP_005716528.1.3957 WP_005716528.1.40210 WP_005716528.1.40787 WP_005716528.1.41297 WP_005716528.1.41351 WP_005716528.1.41462 WP_005716528.1.41657 WP_005716528.1.41667 WP_005716528.1.4211 WP_005716528.1.42469 WP_005716528.1.42512 WP_005716528.1.42943 WP_005716528.1.43687 WP_005716528.1.44741 WP_005716528.1.45422 WP_005716528.1.47685 WP_005716528.1.4808 WP_005716528.1.49053 WP_005716528.1.50853 WP_005716528.1.51342 WP_005716528.1.52066 WP_005716528.1.52585 WP_005716528.1.52859 WP_005716528.1.53852 WP_005716528.1.55074 WP_005716528.1.55401 WP_005716528.1.57420 WP_005716528.1.57956 WP_005716528.1.58111 WP_005716528.1.58257 WP_005716528.1.58450 WP_005716528.1.58628 WP_005716528.1.58910 WP_005716528.1.59455 WP_005716528.1.60478 WP_005716528.1.60664 WP_005716528.1.61098 WP_005716528.1.61860 WP_005716528.1.62016 WP_005716528.1.6219 WP_005716528.1.62389 WP_005716528.1.6332 WP_005716528.1.63549 WP_005716528.1.65482 WP_005716528.1.65878 WP_005716528.1.66934 WP_005716528.1.66990 WP_005716528.1.70689 WP_005716528.1.72215 WP_005716528.1.73917 WP_005716528.1.74955 WP_005716528.1.75804 WP_005716528.1.78987 WP_005716528.1.79347 WP_005716528.1.79593 WP_005716528.1.80223 WP_005716528.1.80589 WP_005716528.1.80911 WP_005716528.1.81885 WP_005716528.1.8281 WP_005716528.1.83579 WP_005716528.1.86541 WP_005716528.1.87897 WP_005716528.1.88402 WP_005716528.1.89773 WP_005716528.1.90081 WP_005716528.1.90179 WP_005716528.1.90578 WP_005716528.1.91495 WP_005716528.1.92478 WP_005716528.1.93940 WP_005716528.1.94432 WP_005716528.1.94435 WP_005716528.1.95718 WP_005716528.1.9746 WP_005716528.1.9947 gi|383310431|ref|YP_005363241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]