SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602641|ref|NP_245713.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602641|ref|NP_245713.1|
Domain Number 1 Region: 2-195
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.49e-48
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00000879
Further Details:      
 
Domain Number 2 Region: 192-288
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.7e-30
Family UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.0000166
Further Details:      
 
Domain Number 3 Region: 284-388
Classification Level Classification E-value
Superfamily UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 2.75e-25
Family UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602641|ref|NP_245713.1|
Sequence length 390
Comment hypothetical protein PM0776 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKITIAGAGYVGLSNAVLLAQHHNVILLDIDQNKVDLINNKKSPITDKEIEDFLQNKSL
TMMATTDKEVALKNADFVIIATPTDYNTETGYFNTSTVEAVIEQTLSINPQATIIIKSTI
PVGFTENMREKFNTPNLIFSPEFLREGKALYDNLYPSRIIVGSTSYQAKVFADMLTQCAR
KKDVTVLFTHNTEAEAVKLFANTYLAMRVAFFNELDTYASLHHLNTKDIINGISTDPRIG
THYNNPSFGYGGYCLPKDTKQLLANYADVPQNLIEAIVKSNETRKRFITHDVLNKKPKTV
GIYRLIMKSGSDNFRASAILDIMPHLKENGVEIVIYEPTLNQQAFEDYPVINQLSEFINR
SDVILANRSEPDLNQCSHKIYTRDIFGGDA
Download sequence
Identical sequences A0A2J9QYR4 Q9CMN9
272843.PM0776 gi|15602641|ref|NP_245713.1| WP_005754204.1.12311 WP_005754204.1.14908 WP_005754204.1.15732 WP_005754204.1.19996 WP_005754204.1.26777 WP_005754204.1.27592 WP_005754204.1.36022 WP_005754204.1.3957 WP_005754204.1.40210 WP_005754204.1.41657 WP_005754204.1.45422 WP_005754204.1.4808 WP_005754204.1.53852 WP_005754204.1.61098 WP_005754204.1.6219 WP_005754204.1.62389 WP_005754204.1.66990 WP_005754204.1.81885 WP_005754204.1.8281 WP_005754204.1.89773 WP_005754204.1.94432 WP_005754204.1.95718 WP_005754204.1.9746 gi|386834074|ref|YP_006239389.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]