SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602655|ref|NP_245727.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602655|ref|NP_245727.1|
Domain Number 1 Region: 183-356
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 4.19e-49
Family PurM C-terminal domain-like 0.00013
Further Details:      
 
Domain Number 2 Region: 25-179
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 8.52e-41
Family PurM N-terminal domain-like 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602655|ref|NP_245727.1|
Sequence length 366
Comment selenophosphate synthetase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQAKIEQNLTALEQEMNDTIASTVRLTQYSHGAGCGCKISPKVLEKILHSDMEKWVDPHL
LVGNETKDDAAVYDIGNGIGIISTTDFFMPIVDDPFDFGRIAATNAISDIFAMGGKPIMA
IAILGFPIKLLPPEVAQRIVDGGRFACRQAGITLAGGHSIDAPEPIFGLAVTGIINTDKV
KKNASATAGCKLFLTKPLGIGVLTTAEKKGKLKAEHQGLATEVMCQMNTIGAKFAEIAGI
SAMTDVTGFGLLGHLSELCEGSGVRAEVYFDKIKTLDGVQRYIEKGCIPGGTERNFESYG
HKIGAMSDLQKAILCDPQTSGGLLIAVDADSEQQVLEIAADDSIELFEVGRLFAKEHDSP
ILITVL
Download sequence
Identical sequences 272843.PM0790 gi|15602655|ref|NP_245727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]