SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602656|ref|NP_245728.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602656|ref|NP_245728.1|
Domain Number 1 Region: 63-315
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.09e-58
Family L-arabinose binding protein-like 0.0000437
Further Details:      
 
Domain Number 2 Region: 5-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000219
Family GalR/LacI-like bacterial regulator 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602656|ref|NP_245728.1|
Sequence length 332
Comment hypothetical protein PM0791 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIKRKRPTLQDIATHLGITKMTISRYLRHPDSVAPETQAKIAQAIEHFGYIPNRAPDILS
NAKSRAIGVLVPSLTNQVFADVIKGIELVSDKAGYQTMLAHYGYSMEKEEQRIESLLSYH
VDGLILSENQHSERTLKMLEVANIPVVEIMECSEVGIQQAIGFDNIAAAQAMVETMIHRG
HKNVVYFSARMDKRTCLKMQGYEQAMKKHGLQPYSLTTEQPSSFSLGAQQLHDALQQRPN
LDGIFCTNDDLAIGALFECQRRGIKVPKQIAIAGFHGHDVGQSMTPQLATVITPRLEIGK
IATQELLNRIHGMPQQSAIINLGYQIHLGESI
Download sequence
Identical sequences A0A1D2NQL6 Q9CMM7
272843.PM0791 gi|15602656|ref|NP_245728.1| gi|386834059|ref|YP_006239374.1| gi|383310471|ref|YP_005363281.1| WP_005751589.1.11014 WP_005751589.1.11214 WP_005751589.1.11947 WP_005751589.1.12156 WP_005751589.1.12311 WP_005751589.1.15732 WP_005751589.1.17980 WP_005751589.1.19996 WP_005751589.1.21657 WP_005751589.1.24757 WP_005751589.1.27592 WP_005751589.1.28084 WP_005751589.1.35562 WP_005751589.1.36022 WP_005751589.1.3807 WP_005751589.1.38246 WP_005751589.1.3839 WP_005751589.1.40210 WP_005751589.1.40787 WP_005751589.1.41297 WP_005751589.1.41657 WP_005751589.1.4211 WP_005751589.1.42469 WP_005751589.1.42512 WP_005751589.1.43687 WP_005751589.1.45422 WP_005751589.1.4808 WP_005751589.1.49053 WP_005751589.1.51342 WP_005751589.1.52585 WP_005751589.1.52859 WP_005751589.1.53852 WP_005751589.1.55074 WP_005751589.1.55401 WP_005751589.1.57956 WP_005751589.1.58257 WP_005751589.1.60478 WP_005751589.1.6219 WP_005751589.1.62389 WP_005751589.1.6332 WP_005751589.1.63549 WP_005751589.1.66990 WP_005751589.1.72215 WP_005751589.1.78987 WP_005751589.1.79347 WP_005751589.1.79593 WP_005751589.1.81885 WP_005751589.1.8281 WP_005751589.1.83579 WP_005751589.1.89773 WP_005751589.1.90578 WP_005751589.1.94432 WP_005751589.1.95718 WP_005751589.1.9746 WP_005751589.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]