SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602678|ref|NP_245750.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602678|ref|NP_245750.1|
Domain Number 1 Region: 191-443
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 7.32e-79
Family Argininosuccinate synthetase, C-terminal domain 0.00000000409
Further Details:      
 
Domain Number 2 Region: 5-187
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.41e-33
Family N-type ATP pyrophosphatases 0.0000000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602678|ref|NP_245750.1|
Sequence length 445
Comment argininosuccinate synthase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSNTILQQLPKGQKVGIAFSGGLDTSAALLWMRQKGAVPYAYTANLGQPDEEDYNAIPRK
AMEYGAENARLIDCRAQLAHEGIAAIQSGAFHISTGGVTYFNTTPLGRAVTGTMLVSAMR
EDDVNIWGDGSTFKGNDIERFYRYGLLTNPNLKIYKPWLDNQFIEELGGRHEMSEFLIAN
GFEYKMSVEKAYSTDSNMLGATHEAKDLEFLNTGIRIVKPIMGVAFWRDDVEVKAEEVTV
RFEEGIPVALNGKTFSDHVELFLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMAL
LHIAYERLVSGIHNEDTIEQYRINGLRLGRLLYQGRWFDPQALMLRETAQRWVARAITGE
VTFELRRGNDYSILNTESPNLTYMPERLSMEKVENAPFDPVDRIGQLTMRNLDIVDTRDK
LGIYTQTGLLSISKDSFLPQLNKKG
Download sequence
Identical sequences A0A1D7R1H5 P57877 V4ND46
gi|383310493|ref|YP_005363303.1| 272843.PM0813 WP_005722481.1.10027 WP_005722481.1.10721 WP_005722481.1.11214 WP_005722481.1.11947 WP_005722481.1.12311 WP_005722481.1.1307 WP_005722481.1.14908 WP_005722481.1.15732 WP_005722481.1.17217 WP_005722481.1.17980 WP_005722481.1.18123 WP_005722481.1.20287 WP_005722481.1.21657 WP_005722481.1.22153 WP_005722481.1.2313 WP_005722481.1.23830 WP_005722481.1.24757 WP_005722481.1.26616 WP_005722481.1.26777 WP_005722481.1.27416 WP_005722481.1.28084 WP_005722481.1.29697 WP_005722481.1.30617 WP_005722481.1.34253 WP_005722481.1.35562 WP_005722481.1.35978 WP_005722481.1.3807 WP_005722481.1.3839 WP_005722481.1.39152 WP_005722481.1.3957 WP_005722481.1.40210 WP_005722481.1.40787 WP_005722481.1.41297 WP_005722481.1.41351 WP_005722481.1.41462 WP_005722481.1.41667 WP_005722481.1.42943 WP_005722481.1.43687 WP_005722481.1.44741 WP_005722481.1.45422 WP_005722481.1.47685 WP_005722481.1.4808 WP_005722481.1.49053 WP_005722481.1.50853 WP_005722481.1.51342 WP_005722481.1.52066 WP_005722481.1.53852 WP_005722481.1.55074 WP_005722481.1.57420 WP_005722481.1.57956 WP_005722481.1.58450 WP_005722481.1.58628 WP_005722481.1.58910 WP_005722481.1.59455 WP_005722481.1.60478 WP_005722481.1.60664 WP_005722481.1.61098 WP_005722481.1.61860 WP_005722481.1.62016 WP_005722481.1.6219 WP_005722481.1.62389 WP_005722481.1.6332 WP_005722481.1.63549 WP_005722481.1.65482 WP_005722481.1.65878 WP_005722481.1.66934 WP_005722481.1.66990 WP_005722481.1.70689 WP_005722481.1.72215 WP_005722481.1.73917 WP_005722481.1.74955 WP_005722481.1.75804 WP_005722481.1.78987 WP_005722481.1.79593 WP_005722481.1.80223 WP_005722481.1.80589 WP_005722481.1.80911 WP_005722481.1.81885 WP_005722481.1.8281 WP_005722481.1.86541 WP_005722481.1.87897 WP_005722481.1.88402 WP_005722481.1.89773 WP_005722481.1.90081 WP_005722481.1.90179 WP_005722481.1.91495 WP_005722481.1.92478 WP_005722481.1.93940 WP_005722481.1.94435 WP_005722481.1.9746 WP_005722481.1.9947 gi|378774524|ref|YP_005176767.1| gi|15602678|ref|NP_245750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]