SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602679|ref|NP_245751.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602679|ref|NP_245751.1|
Domain Number 1 Region: 9-236
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.5e-27
Family Tyrosine-dependent oxidoreductases 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602679|ref|NP_245751.1|
Sequence length 286
Comment hypothetical protein PM0814 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKSVSIVGLGWLGLPLARHLKNLGWEVKGSKRTHEGAEQMRLVRLEAYPLELTPEINADP
DDLTLLLSVDSLVINIPPSQYFFDPQHYVQGIQHLVNEALLHGVSHLIFISSTSVFPEHS
GYFDESCSPQPQSEIAKALVEVEEWLFQLKNIDCDIIRFGGLIGDDRHPVYSLAGKDVKA
GNSPVNLVHFDDCARAIQLLLETPSHQRLYHVVAPKHPTKAEYYSAMAEKLGVATPHFIC
SEQDPVRIIVSDKICQEIDFVYQYPDPYLMLPNEEKSGGLSDGFLK
Download sequence
Identical sequences A0A1D7R1F8 Q9CMK7 V4N5H1
272843.PM0814 gi|383310494|ref|YP_005363304.1| WP_005751603.1.10027 WP_005751603.1.10721 WP_005751603.1.11014 WP_005751603.1.11214 WP_005751603.1.11947 WP_005751603.1.12156 WP_005751603.1.12311 WP_005751603.1.1307 WP_005751603.1.15732 WP_005751603.1.17217 WP_005751603.1.19996 WP_005751603.1.20287 WP_005751603.1.22153 WP_005751603.1.2313 WP_005751603.1.23830 WP_005751603.1.24757 WP_005751603.1.26616 WP_005751603.1.27592 WP_005751603.1.28084 WP_005751603.1.29697 WP_005751603.1.30617 WP_005751603.1.34253 WP_005751603.1.35562 WP_005751603.1.35978 WP_005751603.1.3807 WP_005751603.1.38246 WP_005751603.1.3839 WP_005751603.1.39152 WP_005751603.1.40210 WP_005751603.1.40787 WP_005751603.1.41297 WP_005751603.1.41351 WP_005751603.1.41462 WP_005751603.1.41657 WP_005751603.1.41667 WP_005751603.1.42469 WP_005751603.1.42512 WP_005751603.1.42943 WP_005751603.1.43687 WP_005751603.1.44741 WP_005751603.1.45422 WP_005751603.1.47685 WP_005751603.1.4808 WP_005751603.1.49053 WP_005751603.1.50853 WP_005751603.1.52066 WP_005751603.1.52585 WP_005751603.1.52859 WP_005751603.1.53852 WP_005751603.1.55401 WP_005751603.1.57420 WP_005751603.1.57956 WP_005751603.1.58111 WP_005751603.1.58257 WP_005751603.1.58450 WP_005751603.1.58628 WP_005751603.1.58910 WP_005751603.1.59455 WP_005751603.1.60478 WP_005751603.1.60664 WP_005751603.1.61860 WP_005751603.1.62016 WP_005751603.1.6219 WP_005751603.1.62389 WP_005751603.1.6332 WP_005751603.1.63549 WP_005751603.1.65482 WP_005751603.1.65878 WP_005751603.1.66934 WP_005751603.1.66990 WP_005751603.1.72215 WP_005751603.1.73917 WP_005751603.1.74955 WP_005751603.1.78987 WP_005751603.1.79347 WP_005751603.1.80223 WP_005751603.1.80589 WP_005751603.1.80911 WP_005751603.1.81885 WP_005751603.1.8281 WP_005751603.1.83579 WP_005751603.1.86541 WP_005751603.1.87897 WP_005751603.1.88402 WP_005751603.1.89773 WP_005751603.1.90081 WP_005751603.1.90179 WP_005751603.1.90578 WP_005751603.1.91495 WP_005751603.1.92478 WP_005751603.1.93940 WP_005751603.1.94432 WP_005751603.1.94435 WP_005751603.1.9746 WP_005751603.1.9947 gi|15602679|ref|NP_245751.1| gi|386834036|ref|YP_006239351.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]