SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602683|ref|NP_245755.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602683|ref|NP_245755.1|
Domain Number 1 Region: 5-198,370-577,615-647
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.17e-137
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000686
Further Details:      
 
Domain Number 2 Region: 648-902
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.21e-65
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000439
Further Details:      
 
Domain Number 3 Region: 196-371
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 2.35e-61
Family ValRS/IleRS/LeuRS editing domain 0.0000286
Further Details:      
 
Domain Number 4 Region: 887-949
Classification Level Classification E-value
Superfamily tRNA-binding arm 7.32e-18
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602683|ref|NP_245755.1|
Sequence length 954
Comment valyl-tRNA synthetase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTQNFEMADRFTPSAVEQALYKHWEESGYFKPSEDTSKPSYSIAIPPPNVTGSLHMGHAF
QQTLMDILIRFNRMEGHNTLWQTGTDHAGIATQMVVERKIAAEEGKTRHDYGREAFIDKI
WDWKAYSGGTISQQMRRLGNSIDWERERFTMDEGLSDAVKEVFVRLHEEGLIYRGKRLVN
WDPKLHTAISDLEVENKESKGSLWHFRYPLANGAKTADGKDYLVVATTRPETMLGDTAVA
VHPEDERYQSLIGKTVVLPLANREIPIIADDYVDREFGTGVVKITPAHDFNDYEVGKRHQ
LPMVNVMTLNADIRAEAEIIGSDGKILESYTALIPTKYQGMERFAARKQIVADFEELGLL
DEIKPHDLKVPYGDRGGVPIEPMLTDQWYVSVKPLAEVAVKAVEDGEIQFVPKQYENLYF
SWMRDIQDWCISRQLWWGHRIPAWYDEQGNVYVARDEAEVRAKHNLPADLALKQDEDVLD
TWFSSGLWTFSTLGWPKQTPDLKMFHSTDVLITGFDIIFFWVARMIMFTMHFVKDENGKP
QVPFKTVYVTGLIRDEQGQKMSKSKGNVIDPLDMIDGIDLESLLEKRTGNMMQPQLAEKI
AKATIKAFPEGIAEHGTDALRFTLTALATNGRDINWDMKRLEGYRNFCNKLWNASRFVLT
NDKLDLSEGSVEYSVADRWIQSEFNRTVEAFRNALAQFRFDLCATALYEFTWNQFCDWYL
ELTKPVLVNGSVAQKRGASQTLINVLEKLLRLTHPVMPFITEEIWHKVKAFAGVSGDTIM
LQAFPQFEQSALDYQAEAEINWMKEVIVAVRNIRAESNIPPSKGLDLLLRNLSEADQNAL
ENNRTLIQAMAKLDAIRVLEAGEDAPLSVAKLVNNAELLVPMAGFINKEAELARLNKEIE
KYQGEIQRIENKLANEAFVAKAPPAVIEKERAKMAEYAEGLNKLKQQYLAIEAL
Download sequence
Identical sequences Q9CMK5
272843.PM0818 WP_010906864.1.12311 WP_010906864.1.15732 WP_010906864.1.19996 WP_010906864.1.40210 WP_010906864.1.45422 WP_010906864.1.4808 WP_010906864.1.53852 WP_010906864.1.6219 WP_010906864.1.62389 WP_010906864.1.66990 WP_010906864.1.81885 WP_010906864.1.8281 WP_010906864.1.89773 WP_010906864.1.9746 WP_010906864.1.9947 gi|15602683|ref|NP_245755.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]