SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602699|ref|NP_245771.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602699|ref|NP_245771.1|
Domain Number 1 Region: 163-322
Classification Level Classification E-value
Superfamily PTS IIb component 3.79e-54
Family PTS IIb component 0.00000573
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily PTS system fructose IIA component-like 7.06e-34
Family EIIA-man component-like 0.00000913
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602699|ref|NP_245771.1|
Sequence length 324
Comment hypothetical protein PM0834 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTIAIMIATHGVAAEQLLKTTEMLIGEQDNVATIDFVPGENAETIMTKYQEKLSTTLSHC
DEVLFLVDTWGGSPFNAANRVADGKPNMDIVTGVNVPMLVETFMARDDGPTLPELVAIAL
ETGRTGVRALRYEEEEVATPVQNVEEKPVEPTVVTANGVGHLEIGLARIDDRLIHGQVAT
RWTKESKVSRIVVVNDDVAKDSVRSTMLKSVAPPGVTAHVVDVEKMIRVYNNPEYAGERM
MLLFTNPTDVVRLMEAGVAFKSINVGGMAYKDGKKMITSAVAVDDKDIEAFKKLDAQNIE
LDVRKVSNDSRQYMMDLLKKNNLI
Download sequence
Identical sequences A0A1E3XNX5 Q9CMJ0
gi|15602699|ref|NP_245771.1| 272843.PM0834 WP_005722546.1.11014 WP_005722546.1.12156 WP_005722546.1.12311 WP_005722546.1.14908 WP_005722546.1.15732 WP_005722546.1.17980 WP_005722546.1.19996 WP_005722546.1.26777 WP_005722546.1.3807 WP_005722546.1.38246 WP_005722546.1.3839 WP_005722546.1.3957 WP_005722546.1.40210 WP_005722546.1.41297 WP_005722546.1.41351 WP_005722546.1.41667 WP_005722546.1.42469 WP_005722546.1.45422 WP_005722546.1.4808 WP_005722546.1.49053 WP_005722546.1.52585 WP_005722546.1.52859 WP_005722546.1.53852 WP_005722546.1.55074 WP_005722546.1.55401 WP_005722546.1.57956 WP_005722546.1.58111 WP_005722546.1.58257 WP_005722546.1.60478 WP_005722546.1.61098 WP_005722546.1.6219 WP_005722546.1.62389 WP_005722546.1.63549 WP_005722546.1.66990 WP_005722546.1.70689 WP_005722546.1.72215 WP_005722546.1.79347 WP_005722546.1.79593 WP_005722546.1.81885 WP_005722546.1.8281 WP_005722546.1.83579 WP_005722546.1.88402 WP_005722546.1.89773 WP_005722546.1.90578 WP_005722546.1.92478 WP_005722546.1.93940 WP_005722546.1.9746 WP_005722546.1.9947 gi|383310518|ref|YP_005363328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]