SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602733|ref|NP_245805.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602733|ref|NP_245805.1|
Domain Number 1 Region: 62-314
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.55e-37
Family L-arabinose binding protein-like 0.0007
Further Details:      
 
Domain Number 2 Region: 4-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000148
Family GalR/LacI-like bacterial regulator 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602733|ref|NP_245805.1|
Sequence length 329
Comment DNA-binding transcriptional regulator FruR [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKLKLVELAKLAGVSRTTASYVVNGKAKAYRVSDKTIEKVEKLIKQYDFKPNAMAAGLRA
GKSRTIGLIVPDFENASFARIATHLEAGFRQKGYQLVIACSNDNPETEMQCAKHLIQRQI
DALIVSTTLPADTDFYQRHANIPIICFDRYLDLNKIRVLTDDEGDSYRLATHLGRHCEGK
RMLFLGALPKLGLSRKRELGFRQALSDKVNQVDYLYASQFHKLASAKAFHHWLEKHEMPE
AIFATSLTLLHGVFQILIKRYHRIPRSLIIATFGHHDMLDLLENKVICCVQNHEKIAQTL
LHLVLSRMKSKNVKVSDEVIIREIIESRI
Download sequence
Identical sequences Q9CMG1
gi|15602733|ref|NP_245805.1| 272843.PM0868 WP_010906897.1.12311 WP_010906897.1.15732 WP_010906897.1.19996 WP_010906897.1.45422 WP_010906897.1.4808 WP_010906897.1.53852 WP_010906897.1.62389 WP_010906897.1.66990 WP_010906897.1.9746 WP_010906897.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]