SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602735|ref|NP_245807.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602735|ref|NP_245807.1|
Domain Number 1 Region: 372-569
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.86e-69
Family Pyruvate oxidase and decarboxylase PP module 0.0000241
Further Details:      
 
Domain Number 2 Region: 3-182
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.26e-64
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000491
Further Details:      
 
Domain Number 3 Region: 189-361
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.27e-62
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602735|ref|NP_245807.1|
Sequence length 574
Comment acetolactate synthase 3 catalytic subunit [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKLSGAEMVVQSLRDEGVEFLFGYPGGSVLDIYDAIHTLGGIEHILVRHEQAAVHMADG
YARATGKVGCVLVTSGPGATNTITGIATAYMDSVPLIILSGQVMSGLIGSDAFQECDMVG
ISRPVVKHSFLVKSAAEIPETIKKAFYIASTGRPGPVVIDLPKDVVNPAHKFTYHYPERV
ELRSYNPTIQGHKGQIKKALKALLVAKKPVLFVGGGVITANCSDKLTQFAQTLNLPVTSS
LMGLGAYPSSDKQFLGMLGMHGTYEANNAMHHSDLILGIGVRFDDRTTNNLAKYCPHAKV
IHIDIDPTSISKNVLASIPIVGSAEKVINEFLALLEDDNLLKSQTALDEWWQQIDEWKAV
KCLSFTRDDSVIKPQQVMEVVYRLTQGEAYVASDVGQHQMFAALHYPFNQPRRWINSGGL
GTMGFGLPAALGVKLAYPDSTVVCVTGDGSIQMNIQELSTAQQYDIPIVIISLNNRFLGM
VKQWQDLIYSGRHSQSYMNSLPDFVKLAEAYGHVGIQINTPDELEEKLTQAFSMKDKLVF
VDINVDATEHVYPMQVRGGAMNEMILTKPEKANA
Download sequence
Identical sequences Q9CMF9
WP_010906898.1.12311 WP_010906898.1.15732 WP_010906898.1.19996 WP_010906898.1.40210 WP_010906898.1.45422 WP_010906898.1.4808 WP_010906898.1.53852 WP_010906898.1.6219 WP_010906898.1.62389 WP_010906898.1.66990 WP_010906898.1.81885 WP_010906898.1.8281 WP_010906898.1.89773 WP_010906898.1.9746 WP_010906898.1.9947 gi|15602735|ref|NP_245807.1| 272843.PM0870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]