SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602738|ref|NP_245810.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602738|ref|NP_245810.1|
Domain Number 1 Region: 83-277
Classification Level Classification E-value
Superfamily Formyltransferase 3.27e-59
Family Formyltransferase 0.00013
Further Details:      
 
Domain Number 2 Region: 6-66
Classification Level Classification E-value
Superfamily ACT-like 0.000000666
Family Phenylalanine metabolism regulatory domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602738|ref|NP_245810.1|
Sequence length 278
Comment formyltetrahydrofolate deformylase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIENKILLTDCPDDKGLIAKITNICYKHQLNIIHNNEFVDFDTKHFFMRTELQGIFNEDT
LLADLKFSLPEGTNCRLISAKRKRIVILVTKEAHCLGDILMKNYYGGLDVEIAAVIGNHD
TLRTLVERFDIPFHYISHHDLTRVEHDKLLADKIDEYTPDYIVLAKYMRVLNPQFVEKYP
NRVINIHHSFLPAFIGAKPYHQAYERGVKIIGATAHFINNELDQGPIIMQNVINVDHTYN
AEAMMRAGRDVEKTVLSRALDLALHDRIFVYKNKTVVL
Download sequence
Identical sequences A0A290LNE6 Q9CMF6
WP_005722683.1.12311 WP_005722683.1.15732 WP_005722683.1.19996 WP_005722683.1.40210 WP_005722683.1.41351 WP_005722683.1.41667 WP_005722683.1.45422 WP_005722683.1.4808 WP_005722683.1.53852 WP_005722683.1.6219 WP_005722683.1.62389 WP_005722683.1.66990 WP_005722683.1.70689 WP_005722683.1.81885 WP_005722683.1.8281 WP_005722683.1.88402 WP_005722683.1.89773 WP_005722683.1.92478 WP_005722683.1.93940 WP_005722683.1.9746 WP_005722683.1.9947 gi|15602738|ref|NP_245810.1| 272843.PM0873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]