SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602753|ref|NP_245825.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602753|ref|NP_245825.1|
Domain Number 1 Region: 91-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000994
Family NfeD domain-like 0.0059
Further Details:      
 
Weak hits

Sequence:  gi|15602753|ref|NP_245825.1|
Domain Number - Region: 14-101
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0366
Family Multidrug efflux transporter AcrB transmembrane domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602753|ref|NP_245825.1|
Sequence length 149
Comment hypothetical protein PM0888 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MEWFSTWSLWHWLILGFVLLIAELVIPGVFLLWWGLAAIVIAGVMALIPSLSLTVLAISY
AILAIILSVSWWKYQHGQDKSDQLHSSLNQRDHAMLGTRGTVQEIAANGIGRGHFGDTTW
RIQGTDLQVGDLVEVHQVDGITLKVKKVN
Download sequence
Identical sequences A0A1D7R184 A0A2K2Z0W6 Q9CME2 V4NDB3
272843.PM0888 gi|15602753|ref|NP_245825.1| gi|378774601|ref|YP_005176844.1| gi|383310571|ref|YP_005363381.1| WP_005716922.1.10027 WP_005716922.1.10721 WP_005716922.1.11014 WP_005716922.1.11214 WP_005716922.1.11947 WP_005716922.1.12156 WP_005716922.1.12311 WP_005716922.1.1307 WP_005716922.1.14908 WP_005716922.1.15732 WP_005716922.1.17217 WP_005716922.1.17980 WP_005716922.1.18123 WP_005716922.1.19996 WP_005716922.1.20287 WP_005716922.1.21657 WP_005716922.1.22153 WP_005716922.1.2313 WP_005716922.1.23830 WP_005716922.1.24757 WP_005716922.1.26616 WP_005716922.1.26777 WP_005716922.1.27416 WP_005716922.1.27592 WP_005716922.1.27664 WP_005716922.1.28084 WP_005716922.1.29697 WP_005716922.1.30617 WP_005716922.1.34253 WP_005716922.1.35562 WP_005716922.1.35978 WP_005716922.1.36022 WP_005716922.1.3807 WP_005716922.1.38246 WP_005716922.1.3839 WP_005716922.1.39152 WP_005716922.1.3957 WP_005716922.1.40210 WP_005716922.1.40787 WP_005716922.1.41297 WP_005716922.1.41351 WP_005716922.1.41462 WP_005716922.1.41657 WP_005716922.1.41667 WP_005716922.1.4211 WP_005716922.1.42469 WP_005716922.1.42512 WP_005716922.1.42943 WP_005716922.1.43687 WP_005716922.1.44741 WP_005716922.1.45422 WP_005716922.1.47685 WP_005716922.1.4808 WP_005716922.1.49053 WP_005716922.1.50853 WP_005716922.1.51342 WP_005716922.1.52066 WP_005716922.1.52585 WP_005716922.1.52859 WP_005716922.1.53852 WP_005716922.1.55401 WP_005716922.1.57420 WP_005716922.1.57956 WP_005716922.1.58111 WP_005716922.1.58257 WP_005716922.1.58450 WP_005716922.1.58628 WP_005716922.1.58910 WP_005716922.1.59455 WP_005716922.1.60664 WP_005716922.1.61098 WP_005716922.1.61860 WP_005716922.1.62016 WP_005716922.1.6219 WP_005716922.1.62389 WP_005716922.1.6332 WP_005716922.1.63549 WP_005716922.1.65482 WP_005716922.1.65878 WP_005716922.1.66934 WP_005716922.1.66990 WP_005716922.1.70689 WP_005716922.1.72215 WP_005716922.1.73917 WP_005716922.1.74955 WP_005716922.1.75804 WP_005716922.1.78987 WP_005716922.1.79347 WP_005716922.1.79593 WP_005716922.1.80223 WP_005716922.1.80589 WP_005716922.1.80911 WP_005716922.1.81885 WP_005716922.1.8281 WP_005716922.1.83579 WP_005716922.1.86541 WP_005716922.1.87897 WP_005716922.1.88402 WP_005716922.1.89773 WP_005716922.1.90081 WP_005716922.1.90179 WP_005716922.1.90578 WP_005716922.1.91495 WP_005716922.1.92478 WP_005716922.1.93940 WP_005716922.1.94432 WP_005716922.1.94435 WP_005716922.1.95718 WP_005716922.1.9746 WP_005716922.1.9947 gi|386833959|ref|YP_006239274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]