SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602765|ref|NP_245837.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602765|ref|NP_245837.1|
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.2e-46
Family DnaQ-like 3'-5' exonuclease 0.0000000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602765|ref|NP_245837.1|
Sequence length 184
Comment oligoribonuclease [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQLDKQNLIWIDLEMTGLDPESERIIEIATIVTDKHLNILAEGPVLAIHQSDECLAKMND
WCMKTHTENGLVERVKNSRLTERAAELQTLDFLKKWVPKGVSPICGNSVSQDKRFLFKYM
PELADYFHYRHLDVSTLKELASRWKPDVLKGFTKKNTHLALDDIRESIAELAYYREHFIN
LKNE
Download sequence
Identical sequences A0A1D7R192 A0A2K2Z0U1 P57885 V4MPM4
gi|386833947|ref|YP_006239262.1| WP_005716958.1.10027 WP_005716958.1.10721 WP_005716958.1.11214 WP_005716958.1.11947 WP_005716958.1.12156 WP_005716958.1.12311 WP_005716958.1.1307 WP_005716958.1.14908 WP_005716958.1.15732 WP_005716958.1.17217 WP_005716958.1.17980 WP_005716958.1.18123 WP_005716958.1.19996 WP_005716958.1.20287 WP_005716958.1.21657 WP_005716958.1.22153 WP_005716958.1.2313 WP_005716958.1.23830 WP_005716958.1.24757 WP_005716958.1.26616 WP_005716958.1.26777 WP_005716958.1.27416 WP_005716958.1.27592 WP_005716958.1.27664 WP_005716958.1.28084 WP_005716958.1.29697 WP_005716958.1.30617 WP_005716958.1.34253 WP_005716958.1.35562 WP_005716958.1.35978 WP_005716958.1.36022 WP_005716958.1.3807 WP_005716958.1.38246 WP_005716958.1.3839 WP_005716958.1.39152 WP_005716958.1.3957 WP_005716958.1.40210 WP_005716958.1.40787 WP_005716958.1.41297 WP_005716958.1.41351 WP_005716958.1.41462 WP_005716958.1.41657 WP_005716958.1.41667 WP_005716958.1.4211 WP_005716958.1.42512 WP_005716958.1.42943 WP_005716958.1.43687 WP_005716958.1.44741 WP_005716958.1.45422 WP_005716958.1.47685 WP_005716958.1.4808 WP_005716958.1.49053 WP_005716958.1.50853 WP_005716958.1.51342 WP_005716958.1.52066 WP_005716958.1.52585 WP_005716958.1.52859 WP_005716958.1.53852 WP_005716958.1.55074 WP_005716958.1.55401 WP_005716958.1.57420 WP_005716958.1.57956 WP_005716958.1.58111 WP_005716958.1.58257 WP_005716958.1.58450 WP_005716958.1.58628 WP_005716958.1.58910 WP_005716958.1.59455 WP_005716958.1.60478 WP_005716958.1.60664 WP_005716958.1.61098 WP_005716958.1.61860 WP_005716958.1.62016 WP_005716958.1.6219 WP_005716958.1.62389 WP_005716958.1.6332 WP_005716958.1.63549 WP_005716958.1.65482 WP_005716958.1.65878 WP_005716958.1.66934 WP_005716958.1.66990 WP_005716958.1.72215 WP_005716958.1.73917 WP_005716958.1.74955 WP_005716958.1.75804 WP_005716958.1.78987 WP_005716958.1.79347 WP_005716958.1.79593 WP_005716958.1.80223 WP_005716958.1.80589 WP_005716958.1.80911 WP_005716958.1.81885 WP_005716958.1.8281 WP_005716958.1.83579 WP_005716958.1.86541 WP_005716958.1.87897 WP_005716958.1.88402 WP_005716958.1.89773 WP_005716958.1.90081 WP_005716958.1.90179 WP_005716958.1.91495 WP_005716958.1.92478 WP_005716958.1.93940 WP_005716958.1.94432 WP_005716958.1.94435 WP_005716958.1.95718 WP_005716958.1.9746 WP_005716958.1.9947 272843.PM0900 gi|383310583|ref|YP_005363393.1| gi|378774613|ref|YP_005176856.1| gi|15602765|ref|NP_245837.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]