SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602769|ref|NP_245841.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602769|ref|NP_245841.1|
Domain Number 1 Region: 2-208
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-55
Family DNA gyrase/MutL, N-terminal domain 0.0000000795
Further Details:      
 
Domain Number 2 Region: 190-330
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.48e-41
Family DNA gyrase/MutL, second domain 0.0000157
Further Details:      
 
Domain Number 3 Region: 444-615
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 1.83e-29
Family DNA mismatch repair protein MutL 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602769|ref|NP_245841.1|
Sequence length 617
Comment DNA mismatch repair protein [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAIKVLSPQLANQIAAGEVVERPASVVKELVENSLDAGATRIQIDIENGGSTLIRIRDNG
IGIAKDELSLALARHATSKIASLDDLDNILSLGFRGEALASISSVSRLTLTSRPATQNEA
WQVYAQGREMETTLQPASHPVGTTVEVANLFFNTPARRKFLRTDKTEFAHIDEVIRRIAL
AKMAISFTLTHNGKIVRQYRSAHDRTQKLKRVAAICGDEFVQNALEIDWKHDDLHLSGWV
AQPTFSRTQNDLSYCYINGRMVRDKIITHAIRQAYADFLSPEQYPAFVLFIDLNPNDVDV
NVHPTKHEVRFHQQRLVHDFICQGISNALHSEQASLYQTNEACVSANYQVEESAQHEYRP
SYSKPNRAAAGQNIFDSSTTTPSTALFQTNKKNTQNRPHFSTNIPATRISKTEQAAYSAL
LSNSEMATVLPQEDGALLERKTPSILKALALVENKALLLQQQQQFYLLSLQQLQRLKIEL
SLQRDPVLQQPLLIPIVFRLNPQQLTYWQQQKTFFTQIGFEFHENLGQQRITLNRVPSCL
RQQNLQKCIIVLLSQPLDTFSHFLTTLCDVIELEQITVYADAVTLLTETEQLLNQKQAIR
LSELFIELNWQAYLEKM
Download sequence
Identical sequences P57886
gi|15602769|ref|NP_245841.1| WP_010906909.1.12311 WP_010906909.1.15732 WP_010906909.1.19996 WP_010906909.1.40210 WP_010906909.1.45422 WP_010906909.1.4808 WP_010906909.1.53852 WP_010906909.1.6219 WP_010906909.1.62389 WP_010906909.1.66990 WP_010906909.1.81885 WP_010906909.1.8281 WP_010906909.1.89773 WP_010906909.1.9746 WP_010906909.1.9947 272843.PM0904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]