SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602776|ref|NP_245848.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602776|ref|NP_245848.1|
Domain Number 1 Region: 34-556
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.8e-115
Family Phosphate binding protein-like 0.0000000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602776|ref|NP_245848.1|
Sequence length 563
Comment protein SapA [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MLIRKVIFACFLFLYSHFVTAAPRVPNELTQNGLIYCTHATGFSFNPQTADAGTSMNVIT
EQIYNKLFETSDNSATVIPSLAESYRVSDNGTLITINLRKGVKFHHTEWFTPTRDFNADD
VVFSINRMLGYNSYLPTLDDESIHYSNPQYRIFHKQAKKIRFPYFESIKLNQKIKSIKAI
TPYQVQIKLFQADASILSHLASQYAIIFSQEYALQLNADDNLVQLDLLPVGTGPYKVQNY
FRNQYVRFIRNEHYWKKPAQIKNIIIDLSTDRTGRLVKFLNGECQIVSYPEVSQLGLLQD
KNEHFYVDFVEGMNLSYLAFNFKKPAMKSMKLRRAISQAIDRHRIVQTIYHHTATVANNI
IPSISWASKVNTPDFAYDYAPEKARAFLQDKQLQLTMWVINEEQVYNPSPLKMAELIKRD
LANVGVKVIVQPVTRTYLIERLKAHSEDYDMILAGWLAGNLDPDSFMRPILSCNTVTEIT
NFSNWCDPLFDHFMDNALNTTNLHLRASEYNLAQELILSEVPLIPIANAKRMLVVSPNVQ
GVKMSPFGSINFENLSLRKGAKP
Download sequence
Identical sequences A0A290LYA4 Q9CMC1
WP_005722790.1.12311 WP_005722790.1.14908 WP_005722790.1.15732 WP_005722790.1.19996 WP_005722790.1.3957 WP_005722790.1.40210 WP_005722790.1.41351 WP_005722790.1.41667 WP_005722790.1.45422 WP_005722790.1.4808 WP_005722790.1.53852 WP_005722790.1.55074 WP_005722790.1.58111 WP_005722790.1.61098 WP_005722790.1.6219 WP_005722790.1.62389 WP_005722790.1.66990 WP_005722790.1.70689 WP_005722790.1.81885 WP_005722790.1.88402 WP_005722790.1.89773 WP_005722790.1.92478 WP_005722790.1.93940 WP_005722790.1.9746 WP_005722790.1.9947 272843.PM0911 gi|15602776|ref|NP_245848.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]