SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602789|ref|NP_245861.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602789|ref|NP_245861.1|
Domain Number 1 Region: 149-312
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 2.38e-78
Family GAPDH-like 0.000000117
Further Details:      
 
Domain Number 2 Region: 3-166
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.66e-66
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.000000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602789|ref|NP_245861.1|
Sequence length 334
Comment glyceraldehyde-3-phosphate dehydrogenase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAIKIGINGFGRIGRIVFRAAQHRDDIEVVGINDLIDVEYMAYMLKYDSTHGRFDGTVEV
KDGNLVVNGKTIRVTAERDPANLKWNEIGVEIAVEATGLFLDDATARKHITAGAKKVVLT
GPSKDATPMFVSGVNFDTYAGQDIVSNASCTTNCLAPLAKVINDKFGIKDGLMTTVHATT
ATQKTVDGPSAKDWRGGRGAAQNIIPSSTGAAKAVGKVIPALNGKLTGMAFRVPTPNVSV
VDLTVNLEKPATYAEICAEIKRASENEMKGVLGYTEDAVVSTDFNGCALTSVFDAAAGIA
LTDTFVKLVSWYDNETGYSNKVLDLVAHVYNYKG
Download sequence
Identical sequences A0A1E3XJ40 A0A2K2Z243 Q9CMB0
WP_005717035.1.11014 WP_005717035.1.11214 WP_005717035.1.11947 WP_005717035.1.12156 WP_005717035.1.12311 WP_005717035.1.14908 WP_005717035.1.15732 WP_005717035.1.17980 WP_005717035.1.19996 WP_005717035.1.21657 WP_005717035.1.24757 WP_005717035.1.26777 WP_005717035.1.27592 WP_005717035.1.27664 WP_005717035.1.28084 WP_005717035.1.35562 WP_005717035.1.36022 WP_005717035.1.3807 WP_005717035.1.38246 WP_005717035.1.3839 WP_005717035.1.3957 WP_005717035.1.40210 WP_005717035.1.40787 WP_005717035.1.41351 WP_005717035.1.41657 WP_005717035.1.41667 WP_005717035.1.4211 WP_005717035.1.42469 WP_005717035.1.42512 WP_005717035.1.43687 WP_005717035.1.45422 WP_005717035.1.4808 WP_005717035.1.49053 WP_005717035.1.51342 WP_005717035.1.52585 WP_005717035.1.52859 WP_005717035.1.53852 WP_005717035.1.55074 WP_005717035.1.55401 WP_005717035.1.58111 WP_005717035.1.58257 WP_005717035.1.60478 WP_005717035.1.61098 WP_005717035.1.6219 WP_005717035.1.62389 WP_005717035.1.6332 WP_005717035.1.63549 WP_005717035.1.66990 WP_005717035.1.72215 WP_005717035.1.78987 WP_005717035.1.79347 WP_005717035.1.79593 WP_005717035.1.81885 WP_005717035.1.8281 WP_005717035.1.83579 WP_005717035.1.88402 WP_005717035.1.89773 WP_005717035.1.90578 WP_005717035.1.92478 WP_005717035.1.93940 WP_005717035.1.94432 WP_005717035.1.95718 WP_005717035.1.9746 WP_005717035.1.9947 272843.PM0924 gi|386833924|ref|YP_006239238.1| gi|15602789|ref|NP_245861.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]