SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602805|ref|NP_245877.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602805|ref|NP_245877.1|
Domain Number 1 Region: 124-694
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 7.63e-194
Family Class III anaerobic ribonucleotide reductase NRDD subunit 0.00000000000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15602805|ref|NP_245877.1|
Sequence length 713
Comment anaerobic ribonucleoside triphosphate reductase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MATFFVIKRDGSRTGFEIQRIINAIKKAAQAVNIEDERYCHTMGQQVCNDIFTRYQQEID
ISHIQKIVENTLMAGKYPEIARAYIEYRHDRDLAREKRSQLTKEIEGLIQQSNVELLNEN
ANKDAKVIPTQRDLLAGIVAKHYAKRYILPRDVVDAHEKGEIHYHDLDYAPFFPMFNCML
VDLKGMLSNGFKMGNAEIEPPKSITTATAVSAQIIAQVASHIYGGTTINRIDEILAPYVQ
LSYEKHLKNAAEWKVPEPEAYAKALIEKECFDAFQSLEYEVNTLHTSNGQTPFVTFGFGL
GTTWQSRLIQRSILKNRIRGLGKNHKTPVFPKLVFTIKKGINHSPSDPNYDIKQLALECA
SKRMYPDILNYDQVVKVTGSFKAPMGCRSFLGAYQEQGQEIHDGRNNLGVVSLNLPRIAI
EANATNSAQSAVEFYKILDQRLAIAKKALMTRIARLEHTKARVAPILYMEGACGVRLKAD
DNVAQIFKNGRASISLGYIGIHETINALYGDKHIYDDEQLRQKGIEIVEYLHETVQRWKQ
ETGYAFSLYSTPSENLCDRFCRLDTKQFGLIEGVTDKGYYTNSYHLDVEKKVNPYDKIDF
ELPYPPFASGGFICYGEYPNVQHNLKALEDVWDYSYDRVPYYGTNTPIDECYECGFSGEF
ECTSKGFTCPKCGNHDSEKVSVTRRVCGYLGSPDARPFNAGKQEEVKRRVKHL
Download sequence
Identical sequences Q9CM95
WP_010906933.1.66990 272843.PM0940 gi|15602805|ref|NP_245877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]