SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602806|ref|NP_245878.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602806|ref|NP_245878.1|
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.000000392
Family MoCo biosynthesis proteins 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602806|ref|NP_245878.1|
Sequence length 158
Comment anaerobic ribonucleotide reductase-activating protein [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNYVQYYPTDIVNGEGTRCTLFVSGCTHACRGCYNKKSWSFCAGLPFDEKMEAQILQDLK
DTRIKRQGLTLTGGDPLHPRNLAVLLPFVKRVKHECPDKDLWVWTGYTLAELKADTLQRQ
ILPYIDVLIDGKFEQDKADPSLVWRGSANQIIYRFTQY
Download sequence
Identical sequences A0A1D7R389 A0A2K2Z157 Q9CM94 V4MPR9
gi|15602806|ref|NP_245878.1| 272843.PM0941 gi|383309909|ref|YP_005362719.1| WP_010906934.1.10027 WP_010906934.1.10721 WP_010906934.1.12311 WP_010906934.1.1307 WP_010906934.1.15732 WP_010906934.1.17217 WP_010906934.1.17980 WP_010906934.1.18123 WP_010906934.1.19996 WP_010906934.1.20287 WP_010906934.1.21657 WP_010906934.1.22153 WP_010906934.1.2313 WP_010906934.1.23830 WP_010906934.1.26616 WP_010906934.1.27416 WP_010906934.1.27664 WP_010906934.1.29697 WP_010906934.1.30617 WP_010906934.1.34253 WP_010906934.1.35978 WP_010906934.1.36022 WP_010906934.1.39152 WP_010906934.1.40210 WP_010906934.1.41297 WP_010906934.1.41462 WP_010906934.1.42943 WP_010906934.1.44741 WP_010906934.1.45422 WP_010906934.1.47685 WP_010906934.1.4808 WP_010906934.1.50853 WP_010906934.1.51342 WP_010906934.1.52066 WP_010906934.1.53852 WP_010906934.1.55074 WP_010906934.1.57420 WP_010906934.1.57956 WP_010906934.1.58450 WP_010906934.1.58628 WP_010906934.1.58910 WP_010906934.1.59455 WP_010906934.1.60664 WP_010906934.1.61860 WP_010906934.1.62016 WP_010906934.1.6219 WP_010906934.1.62389 WP_010906934.1.65482 WP_010906934.1.65878 WP_010906934.1.66934 WP_010906934.1.66990 WP_010906934.1.73917 WP_010906934.1.74955 WP_010906934.1.75804 WP_010906934.1.79593 WP_010906934.1.80223 WP_010906934.1.80589 WP_010906934.1.80911 WP_010906934.1.81885 WP_010906934.1.8281 WP_010906934.1.86541 WP_010906934.1.87897 WP_010906934.1.89773 WP_010906934.1.90081 WP_010906934.1.90179 WP_010906934.1.91495 WP_010906934.1.94435 WP_010906934.1.95718 WP_010906934.1.9746 WP_010906934.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]