SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602818|ref|NP_245890.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602818|ref|NP_245890.1|
Domain Number 1 Region: 26-327
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.09e-72
Family Phosphate binding protein-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15602818|ref|NP_245890.1|
Sequence length 345
Comment AfuA [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKFKKLSFAISSALLATGLLASQAYAKGRLVVYCSATNEMCEAEIKAFGEKYDVKTSFIR
NGSGSTFAKIEAEKNNPQADVWYGGTFDPQSQAGELGLLQPYRSPNVDQIVPRFQDPAKV
KGNYTSAIYMGILGFGVNTERLKKLGINEVPKCWKDLTDPRLKGEIQIADPQSSGTAYTA
IATFVQLWGEEAAFDYFKNLHPNISQYTKSGITPSNNTARGETTIGIGFLHDYALQKQQG
APIEMIVPCEGTGYELGGVSILKGARNLDNAKLFVDWVLSKEGQELAWQKGNSLQILTNT
TAQQSPTAFDPTKLNLIDYDFEKYGAADERKRLIGKWVDSIKLSK
Download sequence
Identical sequences A0A1D7R3A2 Q9CM84 V4NDI5
gi|15602818|ref|NP_245890.1| 272843.PM0953 gi|386833878|ref|YP_006239192.1| gi|383309896|ref|YP_005362706.1| WP_005717108.1.10027 WP_005717108.1.10721 WP_005717108.1.11014 WP_005717108.1.11214 WP_005717108.1.11947 WP_005717108.1.12156 WP_005717108.1.12311 WP_005717108.1.1307 WP_005717108.1.15732 WP_005717108.1.17217 WP_005717108.1.19996 WP_005717108.1.20287 WP_005717108.1.22153 WP_005717108.1.2313 WP_005717108.1.23830 WP_005717108.1.26616 WP_005717108.1.26777 WP_005717108.1.27416 WP_005717108.1.27592 WP_005717108.1.28084 WP_005717108.1.29697 WP_005717108.1.30617 WP_005717108.1.34253 WP_005717108.1.35562 WP_005717108.1.35978 WP_005717108.1.36022 WP_005717108.1.3807 WP_005717108.1.38246 WP_005717108.1.3839 WP_005717108.1.39152 WP_005717108.1.40210 WP_005717108.1.41297 WP_005717108.1.41462 WP_005717108.1.41657 WP_005717108.1.42469 WP_005717108.1.42512 WP_005717108.1.42943 WP_005717108.1.43687 WP_005717108.1.44741 WP_005717108.1.45422 WP_005717108.1.4808 WP_005717108.1.49053 WP_005717108.1.52066 WP_005717108.1.52585 WP_005717108.1.52859 WP_005717108.1.53852 WP_005717108.1.55074 WP_005717108.1.55401 WP_005717108.1.57420 WP_005717108.1.57956 WP_005717108.1.58257 WP_005717108.1.58450 WP_005717108.1.58628 WP_005717108.1.58910 WP_005717108.1.59455 WP_005717108.1.60478 WP_005717108.1.60664 WP_005717108.1.61860 WP_005717108.1.62016 WP_005717108.1.6219 WP_005717108.1.62389 WP_005717108.1.6332 WP_005717108.1.63549 WP_005717108.1.65482 WP_005717108.1.65878 WP_005717108.1.66934 WP_005717108.1.66990 WP_005717108.1.72215 WP_005717108.1.73917 WP_005717108.1.75804 WP_005717108.1.78987 WP_005717108.1.79347 WP_005717108.1.80223 WP_005717108.1.80589 WP_005717108.1.80911 WP_005717108.1.81885 WP_005717108.1.8281 WP_005717108.1.83579 WP_005717108.1.86541 WP_005717108.1.87897 WP_005717108.1.89773 WP_005717108.1.90081 WP_005717108.1.90179 WP_005717108.1.90578 WP_005717108.1.91495 WP_005717108.1.94432 WP_005717108.1.94435 WP_005717108.1.95718 WP_005717108.1.9746 WP_005717108.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]