SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15602819|ref|NP_245891.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15602819|ref|NP_245891.1|
Domain Number 1 Region: 24-323
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.41e-66
Family Phosphate binding protein-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15602819|ref|NP_245891.1|
Sequence length 340
Comment AfuA [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKKTHLALFGMLVAGLTATNVAKGEGRLVVYCSAQNVVCEKAVQGFAKKYDVKTSFIRNS
SGSTLAKIDAEKNNPQADVWYGGPFDTHLQAAELGLLSPYPFPKLSEVMPQFQKLGDGKS
SIVYMGVLGFGVNTERLKKLGIKDVPKCWKDLADPRFKNEIQMADPQSSGTAYTAIATFV
QLWGEEQAFDYLKQLDQHISQYPKAGTAPSRNTARGETTVGIGFLQNYSFEKENGAPIEL
VVPCEGTGYELGGISVIKDARNLKNAQLFADWVMSKEAQELSWKEAQSHHVPTNIHAEPS
PYALKPSELNLINYDFDKFGSNEMRSHLIGKWVDKIKLNK
Download sequence
Identical sequences A0A1D2NY73 Q9CM83 V4N5W7
272843.PM0954 WP_005722890.1.11214 WP_005722890.1.11947 WP_005722890.1.12311 WP_005722890.1.15732 WP_005722890.1.17980 WP_005722890.1.19996 WP_005722890.1.21657 WP_005722890.1.23830 WP_005722890.1.26777 WP_005722890.1.27416 WP_005722890.1.27592 WP_005722890.1.28084 WP_005722890.1.35562 WP_005722890.1.36022 WP_005722890.1.3807 WP_005722890.1.38246 WP_005722890.1.3839 WP_005722890.1.40210 WP_005722890.1.41351 WP_005722890.1.41657 WP_005722890.1.41667 WP_005722890.1.42512 WP_005722890.1.43687 WP_005722890.1.45422 WP_005722890.1.4808 WP_005722890.1.49053 WP_005722890.1.51342 WP_005722890.1.52585 WP_005722890.1.53852 WP_005722890.1.55074 WP_005722890.1.55401 WP_005722890.1.57956 WP_005722890.1.58111 WP_005722890.1.58257 WP_005722890.1.60478 WP_005722890.1.6219 WP_005722890.1.62389 WP_005722890.1.6332 WP_005722890.1.63549 WP_005722890.1.66990 WP_005722890.1.70689 WP_005722890.1.72215 WP_005722890.1.75804 WP_005722890.1.78987 WP_005722890.1.79347 WP_005722890.1.81885 WP_005722890.1.8281 WP_005722890.1.88402 WP_005722890.1.89773 WP_005722890.1.92478 WP_005722890.1.93940 WP_005722890.1.94432 WP_005722890.1.95718 WP_005722890.1.9746 gi|15602819|ref|NP_245891.1| gi|386833877|ref|YP_006239191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]